|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 8)| Asymmetric/Biological Unit (3, 8) |
Sites (8, 8)
Asymmetric Unit (8, 8)
|
SS Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1L9L) |
SAPs(SNPs)/Variants (1, 1)
Asymmetric/Biological Unit (1, 1)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1L9L) |
Exons (2, 2)
Asymmetric/Biological Unit (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:74 aligned with GNLY_HUMAN | P22749 from UniProtKB/Swiss-Prot Length:145 Alignment length:74 72 82 92 102 112 122 132 GNLY_HUMAN 63 GRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLR 136 SCOP domains d1l9la_ A: Granulysin, NKG5 protein SCOP domains CATH domains 1l9lA00 A:1-74 NK-Lysin CATH domains Pfam domains -----------------------------------------SapB_2-1l9lA01 A:42-74 Pfam domains SAPs(SNPs) --------------------------------------------------------I----------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------- PROSITE Transcript 1 Exon 1.3a PDB: A:1-23 Exon 1.4c PDB: A:24-74 UniProt: 86-143 Transcript 1 1l9l A 1 GRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLR 74 10 20 30 40 50 60 70
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (6, 6)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (GNLY_HUMAN | P22749)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|