Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF CYTOTOXIN HOMOLOG PRECURSOR
 
Authors :  Y. -J. Sun, W. -G. Wu, C. -M. Chiang, A. -Y. Hsin, C. -D. Hsiao
Date :  29 Aug 96  (Deposition) - 21 Apr 97  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.19
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Venom, Cytotoxin, Cardiotoxin, Multigene Family, Signal (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. J. Sun, W. G. Wu, C. M. Chiang, A. Y. Hsin, C. D. Hsiao
Crystal Structure Of Cardiotoxin V From Taiwan Cobra Venom: Ph-Dependent Conformational Change And A Novel Membrane-Binding Motif Identified In The Three-Finger Loops Of P-Type Cardiotoxin.
Biochemistry V. 36 2403 1997
PubMed-ID: 9054545  |  Reference-DOI: 10.1021/BI962594H
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CARDIOTOXIN V
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organ: VENOM GLAND
    Organism Common: CHINESE COBRA
    Organism Scientific: NAJA ATRA
    Organism Taxid: 8656
    Synonym: CTX A5

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1KXI)

(-) Sites  (0, 0)

(no "Site" information available for 1KXI)

(-) SS Bonds  (8, 8)

Asymmetric/Biological Unit
No.Residues
1A:3 -A:22
2A:15 -A:40
3A:44 -A:55
4A:56 -A:61
5B:3 -B:22
6B:15 -B:40
7B:44 -B:55
8B:56 -B:61

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1KXI)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1KXI)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SNAKE_TOXINPS00272 Snake toxins signature.3SOF5_NAJAT60-80
 		  2A:39-59
B:39-59

(-) Exons   (0, 0)

(no "Exon" information available for 1KXI)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:62
 aligned with 3SOF5_NAJAT | P62375 from UniProtKB/Swiss-Prot  Length:83

    Alignment length:62
                                    31        41        51        61        71        81  
           3SOF5_NAJAT   22 LKCHNTQLPFIYKTCPEGKNLCFKATLKKFPLKFPVKRGCADNCPKNSALLKYVCCSTDKCN 83
               SCOP domains d1kxia_ A: Cardiotoxin V                                       SCOP domains
               CATH domains 1kxiA00 A:1-62 CD59                                            CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.......eee......eeeee...........eeeee..................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------SNAKE_TOXIN          --- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                  1kxi A  1 LKCHNTQLPFIYKTCPEGKNLCFKATLKKFPLKFPVKRGCADNCPKNSALLKYVCCSTDKCN 62
                                    10        20        30        40        50        60  


Chain B from PDB  Type:PROTEIN  Length:62
 aligned with 3SOF5_NAJAT | P62375 from UniProtKB/Swiss-Prot  Length:83

    Alignment length:62
                                    31        41        51        61        71        81  
           3SOF5_NAJAT   22 LKCHNTQLPFIYKTCPEGKNLCFKATLKKFPLKFPVKRGCADNCPKNSALLKYVCCSTDKCN 83
               SCOP domains d1kxib_ B: Cardiotoxin V                                       SCOP domains
               CATH domains 1kxiB00 B:1-62 CD59                                            CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.......eee......eeeeeee.........eeeee.........eeeeee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------SNAKE_TOXIN          --- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                  1kxi B  1 LKCHNTQLPFIYKTCPEGKNLCFKATLKKFPLKFPVKRGCADNCPKNSALLKYVCCSTDKCN 62
                                    10        20        30        40        50        60
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Small proteins (3458)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1KXI)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (3SOF5_NAJAT | P62375)
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0044218    other organism cell membrane    The cell membrane of a secondary organism with which the first organism is interacting.
    GO:0044279    other organism membrane    A membrane of a secondary organism with which the first organism is interacting.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1kxi)
 
  Sites
(no "Sites" information available for 1kxi)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1kxi)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1kxi
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  3SOF5_NAJAT | P62375
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  3SOF5_NAJAT | P62375
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        3SOF5_NAJAT | P62375: 1cvo

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1KXI)