|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1KQX) |
Sites (0, 0)| (no "Site" information available for 1KQX) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1KQX) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1KQX) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1KQX) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1KQX) |
Exons (4, 4)
Asymmetric/Biological Unit (4, 4)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:134 aligned with Q8UVG6_DANRE | Q8UVG6 from UniProtKB/TrEMBL Length:135 Alignment length:134 11 21 31 41 51 61 71 81 91 101 111 121 131 Q8UVG6_DANRE 2 PADFNGTWEMLSNDNFEDVMKALDIDFATRKIAVHLKQTKVIVQNGDKFETKTLSTFRNYEVNFVIGEEFDEQTKGLDNRTVKTLVKWDGDKLVCVQKGEKENRGWKQWIEGDLLHLEIHCQDKVCHQVFKKKN 135 SCOP domains d1kqxa_ A: Cellular retinol-binding protein II (CRBP) SCOP domains CATH domains 1kqxA00 A:1-134 [code=2.40.128.20, no name defined] CATH domains Pfam domains ----Lipocalin-1kqxA01 A:5-133 - Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript 1 (1) Exon 1.1 PDB: A:1-24 -----------------------------------------------------------Exon 1.3 PDB: A:84-117 Exon 1.4 Transcript 1 (1) Transcript 1 (2) -----------------------Exon 1.2 PDB: A:24-83 UniProt: 25-84 --------------------------------------------------- Transcript 1 (2) 1kqx A 1 PADFNGTWEMLSNDNFEDVMKALDIDFATRKIAVHLKQTKVIVQNGDKFETKTLSTFRNYEVNFVIGEEFDEQTKGLDNRTVKTLVKWDGDKLVCVQKGEKENRGWKQWIEGDLLHLEIHCQDKVCHQVFKKKN 134 10 20 30 40 50 60 70 80 90 100 110 120 130
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (5, 5)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q8UVG6_DANRE | Q8UVG6)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|