1KQW - JenaLib

Title :   CRYSTAL STRUCTURE OF HOLO-CRBP FROM ZEBRAFISH

Authors :   V. Calderone, C. Folli, A. Marchesani, R. Berni, G. Zanotti

Date :   08 Jan 02 (Deposition) - 28 Aug 02 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.38

Chains :   Asym./Biol. Unit : A

Keywords :   Retinol, Vitamin A, Retinol-Binding, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   V. Calderone, C. Folli, A. Marchesani, R. Berni, G. Zanotti
Identification And Structural Analysis Of A Zebrafish Apo And Holo Cellular Retinol-Binding Protein.
J. Mol. Biol. V. 321 527 2002
PubMed-ID: 12162964 | Reference-DOI: 10.1016/S0022-2836(02)00628-9
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (4, 4)

Asymmetric/Biological Unit (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSDART00000102459	1	ENSDARE00000735502	chr15:5708818-5708632	187	Q8UVG6_DANRE	1-25	25	1	A:1-24	24
1.2	ENSDART00000102459	2	ENSDARE00000735489	chr15:5703284-5703106	179	Q8UVG6_DANRE	25-84	60	1	A:24-83	60
1.3	ENSDART00000102459	3	ENSDARE00000735481	chr15:5699268-5699167	102	Q8UVG6_DANRE	85-118	34	1	A:84-117	34
1.4	ENSDART00000102459	4	ENSDARE00000735473	chr15:5697470-5697322	149	Q8UVG6_DANRE	119-135	17	1	A:118-134	17

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:134
 aligned with Q8UVG6_DANRE | Q8UVG6 from UniProtKB/TrEMBL  Length:135

    Alignment length:134
                                    11        21        31        41        51        61        71        81        91       101       111       121       131    
         Q8UVG6_DANRE     2 PADFNGTWEMLSNDNFEDVMKALDIDFATRKIAVHLKQTKVIVQNGDKFETKTLSTFRNYEVNFVIGEEFDEQTKGLDNRTVKTLVKWDGDKLVCVQKGEKENRGWKQWIEGDLLHLEIHCQDKVCHQVFKKKN 135
               SCOP domains d1kqwa_ A: Cellular retinol-binding protein II (CRBP)                                                                                  SCOP domains
               CATH domains 1kqwA00 A:1-134  [code=2.40.128.20, no name defined]                                                                                   CATH domains
               Pfam domains ----Lipocalin-1kqwA01 A:5-133                                                                                                        - Pfam domains
         Sec.struct. author .....eeeeeeeeehhhhhhhhh..hhhhhhhhhh...eeeeeee..eeeeeee.....eeeeee....eeee.......eeeeeeeee..eeeeeee......eeeeeee..eeeeeeee..eeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: A:1-24   -----------------------------------------------------------Exon 1.3  PDB: A:84-117           Exon 1.4          Transcript 1 (1)
           Transcript 1 (2) -----------------------Exon 1.2  PDB: A:24-83 UniProt: 25-84                       --------------------------------------------------- Transcript 1 (2)
                 1kqw A   1 PADFNGTWEMLSNDNFEDVMKALDIDFATRKIAVHLKQTKVIVQNGDKFETKTLSTFRNYEVNFVIGEEFDEQTKGLDNRTVKTLVKWDGDKLVCVQKGEKENRGWKQWIEGDLLHLEIHCQDKVCHQVFKKKN 134
                                    10        20        30        40        50        60        70        80        90       100       110       120       130

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (Q8UVG6_DANRE | Q8UVG6)

molecular function
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
	GO:0016918	retinal binding	Interacting selectively and non-covalently with retinal, one of the forms of vitamin A. Retinal plays an important role in the visual process in most vertebrates, combining with opsins to form visual pigments in the retina.
	GO:0005215	transporter activity	Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0006776	vitamin A metabolic process	The chemical reactions and pathways involving any of the vitamin A compounds, retinol, retinal (retinaldehyde) and retinoic acid, all of which are derivatives of beta-carotene.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		RTL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1kqw)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1kqw
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q8UVG6_DANRE \| Q8UVG6
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	Q8UVG6_DANRE \| Q8UVG6
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description