1KQ5 - JenaLib

Asymmetric Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	C_CAP_COFACTOR_C	PS51329	C-CAP/cofactor C-like domain profile.	CAP_YEAST	369-504	2	A:1369-1504 B:2369-2504
2	CAP_2	PS01089	CAP protein signature 2.	CAP_YEAST	498-509	2	A:1498-1509 B:2498-2509

Biological Unit 1 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	C_CAP_COFACTOR_C	PS51329	C-CAP/cofactor C-like domain profile.	CAP_YEAST	369-504	1	A:1369-1504 -
2	CAP_2	PS01089	CAP protein signature 2.	CAP_YEAST	498-509	1	A:1498-1509 -

Biological Unit 2 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	C_CAP_COFACTOR_C	PS51329	C-CAP/cofactor C-like domain profile.	CAP_YEAST	369-504	1	- B:2369-2504
2	CAP_2	PS01089	CAP protein signature 2.	CAP_YEAST	498-509	1	- B:2498-2509

Biological Unit 3 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	C_CAP_COFACTOR_C	PS51329	C-CAP/cofactor C-like domain profile.	CAP_YEAST	369-504	2	- B:2369-2504
2	CAP_2	PS01089	CAP protein signature 2.	CAP_YEAST	498-509	2	- B:2498-2509

Biological Unit 4 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	C_CAP_COFACTOR_C	PS51329	C-CAP/cofactor C-like domain profile.	CAP_YEAST	369-504	2	A:1369-1504 -
2	CAP_2	PS01089	CAP protein signature 2.	CAP_YEAST	498-509	2	A:1498-1509 -

Exons (1, 2)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:156
 aligned with CAP_YEAST | P17555 from UniProtKB/Swiss-Prot  Length:526

    Alignment length:156
                                   377       387       397       407       417       427       437       447       457       467       477       487       497       507       517      
           CAP_YEAST    368 RPPRKELVGNKWFIENYENETESLVIDANKDESIFIGKCSQVLVQIKGKVNAISLSETESCSVVLDSSISGMDVIKSNKFGIQVNHSLPQISIDKSDGGNIYLSKESLNTEIYTSCSTAINVNLPIGEDDDYVEFPIPEQMKHSFADGKFKSAVFE  523
               SCOP domains d1kq5a_ A: C-terminal domain of adenylylcyclase associated protein                                                                                           SCOP domains
               CATH domains 1kq5A00 A:1368-1523  [code=2.160.20.70, no name defined]                                                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee..eeeeeee......eeee.....eeeeeeeeeeeeeee....eeeeeeeeeeeeee......eeeeeeeeeeeee.....eeeee..eeeeee..hhhhh.eeeee..eeeeee.................eeeeee..eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -C_CAP_COFACTOR_C  PDB: A:1369-1504 UniProt: 369-504                                                                                     ------------------- PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------CAP_2       -------------- PROSITE (2)
               Transcript 1 Exon 1.1  PDB: A:1368-1523 UniProt: 1-526 [INCOMPLETE]                                                                                                       Transcript 1
                1kq5 A 1368 MPPRKELVGNKWFIENYENETESLVIDANKDESIFIGKCSQVLVQIKGKVNAISLSETESCSVVLDSSISGMDVIKSNKFGIQVNHSLPQISIDKSDGGNIYLSKESLNTEIYTSCSTAINVNLPIGEDDDYVEFPISEQMKHSFADGKFKSAVFE 1523
                                  1377      1387      1397      1407      1417      1427      1437      1447      1457      1467      1477      1487      1497      1507      1517

Chain B from PDB  Type:PROTEIN  Length:156
 aligned with CAP_YEAST | P17555 from UniProtKB/Swiss-Prot  Length:526

    Alignment length:156
                                   377       387       397       407       417       427       437       447       457       467       477       487       497       507       517      
           CAP_YEAST    368 RPPRKELVGNKWFIENYENETESLVIDANKDESIFIGKCSQVLVQIKGKVNAISLSETESCSVVLDSSISGMDVIKSNKFGIQVNHSLPQISIDKSDGGNIYLSKESLNTEIYTSCSTAINVNLPIGEDDDYVEFPIPEQMKHSFADGKFKSAVFE  523
               SCOP domains d1kq5b_ B: C-terminal domain of adenylylcyclase associated protein                                                                                           SCOP domains
               CATH domains 1kq5B00 B:2368-2523  [code=2.160.20.70, no name defined]                                                                                                     CATH domains
           Pfam domains (1) -CAP_C-1kq5B01 B:2369-2523                                                                                                                                   Pfam domains (1)
           Pfam domains (2) -CAP_C-1kq5B02 B:2369-2523                                                                                                                                   Pfam domains (2)
         Sec.struct. author ...eeeee..eeeeeee......eeee.....eeeeeeeeeeeeeee....eeeeeeeeeeeeee......eeeeeeeeeeeee.....eeeee..eeeeee........eeeee..eeeeeee..hhhhh.eeee....eeeeee..eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -C_CAP_COFACTOR_C  PDB: B:2369-2504 UniProt: 369-504                                                                                     ------------------- PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------CAP_2       -------------- PROSITE (2)
               Transcript 1 Exon 1.1  PDB: B:2368-2523 UniProt: 1-526 [INCOMPLETE]                                                                                                       Transcript 1
                1kq5 B 2368 MPPRKELVGNKWFIENYENETESLVIDANKDESIFIGKCSQVLVQIKGKVNAISLSETESCSVVLDSSISGMDVIKSNKFGIQVNHSLPQISIDKSDGGNIYLSKESLNTEIYTSCSTAINVNLPIGEDDDYVEFPISEQMKHSFADGKFKSAVFE 2523
                                  2377      2387      2397      2407      2417      2427      2437      2447      2457      2467      2477      2487      2497      2507      2517

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (12, 12)

Asymmetric Unit(hide GO term definitions)

Chain A,B (CAP_YEAST | P17555)

molecular function
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0008179	adenylate cyclase binding	Interacting selectively and non-covalently with the enzyme adenylate cyclase.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0007265	Ras protein signal transduction	A series of molecular signals within the cell that are mediated by a member of the Ras superfamily of proteins switching to a GTP-bound active state.
	GO:0007015	actin filament organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments. Includes processes that control the spatial distribution of actin filaments, such as organizing filaments into meshworks, bundles, or other structures, as by cross-linking.
	GO:0051014	actin filament severing	The process in which an actin filament is broken down into smaller filaments.
	GO:0000902	cell morphogenesis	The developmental process in which the size or shape of a cell is generated and organized.
	GO:0007010	cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures.
cellular component
	GO:0030479	actin cortical patch	An endocytic patch that consists of an actin-containing structure found at the plasma membrane in cells; formed of networks of branched actin filaments that lie just beneath the plasma membrane and assemble, move, and disassemble rapidly. An example of this is the actin cortical patch found in Saccharomyces cerevisiae.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1kq5)

	Sites
(no "Sites" information available for 1kq5)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1kq5)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1kq5
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CAP_YEAST \| P17555
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 4)