Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE C-TERMINAL PABC DOMAIN OF HUMAN POLY(A)-BINDING PROTEIN IN COMPLEX WITH THE PEPTIDE FROM PAIP2
 
Authors :  G. Kozlov, N. Siddiqui, S. Coillet-Matillon, I. Ekiel, K. Gehring
Date :  26 Jun 01  (Deposition) - 24 Jun 03  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (30x)
Keywords :  All-Helical Domain, Protein-Peptide Complex, Rna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. Kozlov, G. De Crescenzo, N. S. Lim, N. Siddiqui, D. Fantus, A. Kahvejian, J. F. Trempe, D. Elias, I. Ekiel, N. Sonenberg, M. O'Connor-Mccourt, K. Gehring
Structural Basis Of Ligand Recognition By Pabc, A Highly Specific Peptide-Binding Domain Found In Poly(A)-Binding Protein And A Hect Ubiquitin Ligase
Embo J. V. 23 272 2004
PubMed-ID: 14685257  |  Reference-DOI: 10.1038/SJ.EMBOJ.7600048
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - POLYADENYLATE-BINDING PROTEIN 1
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPGEX-6P-1
    Expression System StrainBL21 GOLD
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentC-TERMINAL DOMAIN
    GenePABPC1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPABP1
 
Molecule 2 - POLYADENYLATE-BINDING PROTEIN-INTERACTING PROTEIN 2
    ChainsB
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPGEX-6P-1
    Expression System StrainBL21 GOLD
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentC-TERMINAL 22 RESIDUES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPAIP2

 Structural Features

(-) Chains, Units

  
NMR Structure (30x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1JGN)

(-) Sites  (0, 0)

(no "Site" information available for 1JGN)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1JGN)

(-) Cis Peptide Bonds  (5, 16)

NMR Structure
No.ModelResidues
13, 9, 16, 20Ser A:5 -Pro A:6
25, 10, 13Pro A:16 -Pro A:17
311, 18, 24, 25, 30Gly A:1 -Pro A:2
412, 24Val A:95 -Pro A:96
528, 29His A:36 -Pro A:37

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1JGN)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PABCPS51309 Poly(A)-binding protein C-terminal (PABC) domain profile.PABP1_HUMAN542-619  1A:6-81

(-) Exons   (6, 6)

NMR Structure (6, 6)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1eENST000003186071eENSE00002107718chr8:101734940-1017336191322PABP1_HUMAN1-65650--
1.2eENST000003186072eENSE00002179154chr8:101730508-101730315194PABP1_HUMAN65-129650--
1.2iENST000003186072iENSE00001088711chr8:101730116-101730001116PABP1_HUMAN130-168390--
1.3bENST000003186073bENSE00001676241chr8:101727829-101727690140PABP1_HUMAN168-215480--
1.4cENST000003186074cENSE00001088702chr8:101725409-10172531595PABP1_HUMAN215-246320--
1.5aENST000003186075aENSE00001088717chr8:101725017-101724880138PABP1_HUMAN247-292460--
1.6aENST000003186076aENSE00001088710chr8:101724685-10172459096PABP1_HUMAN293-324320--
1.7bENST000003186077bENSE00002184139chr8:101721959-101721687273PABP1_HUMAN325-415910--
1.8cENST000003186078cENSE00001088708chr8:101721451-10172136191PABP1_HUMAN416-446310--
1.9bENST000003186079bENSE00001088705chr8:101719225-101719115111PABP1_HUMAN446-483380--
1.10bENST0000031860710bENSE00002199412chr8:101719033-101718879155PABP1_HUMAN483-534521A:1-22
1.11ENST0000031860711ENSE00001088703chr8:101717901-10171781785PABP1_HUMAN535-563291A:3-25 (gaps)24
1.12aENST0000031860712aENSE00001088713chr8:101717284-101717154131PABP1_HUMAN563-606441A:25-6844
1.13aENST0000031860713aENSE00001088716chr8:101716618-10171652594PABP1_HUMAN607-636301A:69-9830
1.14eENST0000031860714eENSE00001378950chr8:101715587-101715144444PABP1_HUMAN-00--

2.2aENST000003947952aENSE00002078456chr5:138678131-138679095965PAIP2_HUMAN-00--
2.3aENST000003947953aENSE00002142227chr5:138699448-138699611164PAIP2_HUMAN1-46460--
2.4bENST000003947954bENSE00000817513chr5:138700253-138700432180PAIP2_HUMAN47-106601B:1-11
2.5eENST000003947955eENSE00001317427chr5:138704422-138705406985PAIP2_HUMAN107-127211B:2-2221

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:98
 aligned with PABP1_HUMAN | P11940 from UniProtKB/Swiss-Prot  Length:636

    Alignment length:146
                                   500       510       520       530       540       550       560       570       580       590       600       610       620       630      
          PABP1_HUMAN   491 GPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV 636
               SCOP domains d1                                               jg na_ A: poly(A) binding protein                                                                 SCOP domains
               CATH domains 1j                                               gn A00 A:1-98 c-terminal domain of poly(a) binding protein                                        CATH domains
               Pfam domains -----------------------------------------------------PABP-1jgnA01 A:6-76                                                    ---------------------- Pfam domains
         Sec.struct. author ..-----------------------------------------------..-..hhhhhhhh.hhhhh......hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------PABC  PDB: A:6-81 UniProt: 542-619                                            ----------------- PROSITE
           Transcript 1 (1) Exon 1.10b  PDB: A:1-2 UniProt: 483-534     Exon 1.11  PDB: A:3-25 (gaps)-------------------------------------------Exon 1.13a  PDB: A:69-98       Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------Exon 1.12a  PDB: A:25-68 UniProt: 563-606   ------------------------------ Transcript 1 (2)
                 1jgn A   1 GP-----------------------------------------------LG-SPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV  98
                             |       -         -         -         -         3| |     12        22        32        42        52        62        72        82        92      
                             2                                               3| 5                                                                                             
                                                                              4                                                                                               

Chain B from PDB  Type:PROTEIN  Length:22
 aligned with PAIP2_HUMAN | Q9BPZ3 from UniProtKB/Swiss-Prot  Length:127

    Alignment length:22
                                   115       125  
          PAIP2_HUMAN   106 VVKSNLNPNAKEFVPGVKYGNI 127
               SCOP domains ---------------------- SCOP domains
               CATH domains ---------------------- CATH domains
               Pfam domains -PAM2-1jgnB01     ---- Pfam domains
         Sec.struct. author ...................... Sec.struct. author
                 SAPs(SNPs) ---------------------- SAPs(SNPs)
                    PROSITE ---------------------- PROSITE
               Transcript 2 2Exon 2.5e  PDB: B:2-2 Transcript 2
                 1jgn B   1 VVKSNLNPNAKEFVPGVKYGNI  22
                                    10        20  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure

(-) Pfam Domains  (2, 2)

NMR Structure

(-) Gene Ontology  (42, 44)

NMR Structure(hide GO term definitions)
Chain A   (PABP1_HUMAN | P11940)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0008143    poly(A) binding    Interacting selectively and non-covalently with a sequence of adenylyl residues in an RNA molecule, such as the poly(A) tail, a sequence of adenylyl residues at the 3' end of eukaryotic mRNA.
    GO:0008266    poly(U) RNA binding    Interacting selectively and non-covalently with a sequence of uracil residues in an RNA molecule.
    GO:0008022    protein C-terminus binding    Interacting selectively and non-covalently with a protein C-terminus, the end of any peptide chain at which the 1-carboxy function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0008494    translation activator activity    Any of a group of soluble proteins functioning in the activation of ribosome-mediated translation of mRNA into a polypeptide.
biological process
    GO:0008380    RNA splicing    The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
    GO:0031047    gene silencing by RNA    Any process in which RNA molecules inactivate expression of target genes.
    GO:0006378    mRNA polyadenylation    The enzymatic addition of a sequence of 40-200 adenylyl residues at the 3' end of a eukaryotic mRNA primary transcript.
    GO:0006397    mRNA processing    Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
    GO:0000398    mRNA splicing, via spliceosome    The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
    GO:0048255    mRNA stabilization    Prevention of degradation of mRNA molecules. In the absence of compensating changes in other processes, the slowing of mRNA degradation can result in an overall increase in the population of active mRNA molecules.
    GO:2000623    negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay    Any process that stops, prevents or reduces the frequency, rate or extent of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay.
    GO:0000184    nuclear-transcribed mRNA catabolic process, nonsense-mediated decay    The nonsense-mediated decay pathway for nuclear-transcribed mRNAs degrades mRNAs in which an amino-acid codon has changed to a nonsense codon; this prevents the translation of such mRNAs into truncated, and potentially harmful, proteins.
    GO:0000289    nuclear-transcribed mRNA poly(A) tail shortening    Shortening of the poly(A) tail of a nuclear-transcribed mRNA from full length to an oligo(A) length.
    GO:1900153    positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay    Any process that activates or increases the frequency, rate or extent of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay.
    GO:0060213    positive regulation of nuclear-transcribed mRNA poly(A) tail shortening    Any process that increases the frequency, rate or extent of poly(A) tail shortening of a nuclear-transcribed mRNA. Poly(A) tail shortening is the decrease in length of the poly(A) tail of an mRNA from full length to an oligo(A) length.
    GO:0045727    positive regulation of translation    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
    GO:0045070    positive regulation of viral genome replication    Any process that activates or increases the frequency, rate or extent of viral genome replication.
    GO:0043488    regulation of mRNA stability    Any process that modulates the propensity of mRNA molecules to degradation. Includes processes that both stabilize and destabilize mRNAs.
    GO:0006413    translational initiation    The process preceding formation of the peptide bond between the first two amino acids of a protein. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.
cellular component
    GO:0071013    catalytic step 2 spliceosome    A spliceosomal complex that contains three snRNPs, including U5, bound to a splicing intermediate in which the first catalytic cleavage of the 5' splice site has occurred. The precise subunit composition differs significantly from that of the catalytic step 1, or activated, spliceosome, and includes many proteins in addition to those found in the associated snRNPs.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0036464    cytoplasmic ribonucleoprotein granule    A ribonucleoprotein granule located in the cytoplasm.
    GO:0010494    cytoplasmic stress granule    A dense aggregation in the cytosol composed of proteins and RNAs that appear when the cell is under stress.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005925    focal adhesion    Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005681    spliceosomal complex    Any of a series of ribonucleoprotein complexes that contain snRNA(s) and small nuclear ribonucleoproteins (snRNPs), and are formed sequentially during the spliceosomal splicing of one or more substrate RNAs, and which also contain the RNA substrate(s) from the initial target RNAs of splicing, the splicing intermediate RNA(s), to the final RNA products. During cis-splicing, the initial target RNA is a single, contiguous RNA transcript, whether mRNA, snoRNA, etc., and the released products are a spliced RNA and an excised intron, generally as a lariat structure. During trans-splicing, there are two initial substrate RNAs, the spliced leader RNA and a pre-mRNA.

Chain B   (PAIP2_HUMAN | Q9BPZ3)
molecular function
    GO:0003729    mRNA binding    Interacting selectively and non-covalently with messenger RNA (mRNA), an intermediate molecule between DNA and protein. mRNA includes UTR and coding sequences, but does not contain introns.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0030371    translation repressor activity    Antagonizes ribosome-mediated translation of mRNA into a polypeptide.
biological process
    GO:0007613    memory    The activities involved in the mental information processing system that receives (registers), modifies, stores, and retrieves informational stimuli. The main stages involved in the formation and retrieval of memory are encoding (processing of received information by acquisition), storage (building a permanent record of received information as a result of consolidation) and retrieval (calling back the stored information and use it in a suitable way to execute a given task).
    GO:0017148    negative regulation of translation    Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
    GO:0045947    negative regulation of translational initiation    Any process that stops, prevents, or reduces the frequency, rate or extent of translational initiation.
    GO:1900271    regulation of long-term synaptic potentiation    Any process that modulates the frequency, rate or extent of long-term synaptic potentiation.
    GO:0006417    regulation of translation    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
    GO:0007283    spermatogenesis    The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1jgn)
 
  Sites
(no "Sites" information available for 1jgn)
 
  Cis Peptide Bonds
    Gly A:1 - Pro A:2   [ RasMol ]  
    His A:36 - Pro A:37   [ RasMol ]  
    Pro A:16 - Pro A:17   [ RasMol ]  
    Ser A:5 - Pro A:6   [ RasMol ]  
    Val A:95 - Pro A:96   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1jgn
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PABP1_HUMAN | P11940
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PAIP2_HUMAN | Q9BPZ3
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PABP1_HUMAN | P11940
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PAIP2_HUMAN | Q9BPZ3
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PABP1_HUMAN | P119401cvj 1g9l 1jh4 2k8g 2rqg 2rqh 2x04 3ktp 3ktr 3kui 3kuj 3kur 3kus 3kut 3pkn 3pth 4f02 4f25 4f26 5dx1 5dx8 5dxa 5lgp 5lgq 5lgr 5lgs
        PAIP2_HUMAN | Q9BPZ33kus 3kut

(-) Related Entries Specified in the PDB File

1g9l 1G9L CONTAINS THE UNCOMPLEXED C-TERMINAL DOMAIN OF HUMAN POLY(A)-BINDING PROTEIN