|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 7)
Asymmetric Unit (3, 7)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1J5Y) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1J5Y) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1J5Y) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1J5Y) |
Exons (0, 0)| (no "Exon" information available for 1J5Y) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:172 aligned with NIAR_THEMA | Q9X1T8 from UniProtKB/Swiss-Prot Length:175 Alignment length:172 12 22 32 42 52 62 72 82 92 102 112 122 132 142 152 162 172 NIAR_THEMA 3 MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGGKSGVSRLVAVKHAPEEIKEELLCVVRNGGRIVDVIVEHPVYGEIRGIIDVSSEEEVLKFVNLMEMAKTEPLLTLSGGVHLHTIEAPDEETMERIMRELKKKGFLIEE 174 SCOP domains d1j5ya1 A:3-67 d1j5ya2 A:68-174 Putative transcriptional regulator TM1602, C-terminal domain SCOP domains CATH domains -1j5yA01 A:4-67 'winged helix' repressor DNA binding domain 1j5yA02 A:68-174 Putative transcriptional regulator TM1602, C-terminal domain CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1j5y A 3 mKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGGKSGVSRLVAVKHAPEEIKEELLCVVRNGGRIVDVIVEHPVYGEIRGIIDVSSEEEVLKFVNLmEmAKTEPLLTLSGGVHLHTIEAPDEETmERImRELKKKGFLIEE 174 | 12 22 32 42 52 62 72 82 92 102 112 122 132 142 152 | 162 172 | 130-MSE 158-MSE 3-MSE 132-MSE 162-MSE
|
||||||||||||||||||||
SCOP Domains (2, 2)| Asymmetric Unit |
CATH Domains (2, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1J5Y) |
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A (NIAR_THEMA | Q9X1T8)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|