Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  GLUTAMATE MUTASE FROM CLOSTRIDIUM COCHLEARIUM: COMPLEX WITH ADENOSYLCOBALAMIN AND SUBSTRATE
 
Authors :  K. Gruber, C. Kratky
Date :  19 Mar 01  (Deposition) - 19 Mar 02  (Release) - 24 Oct 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Coenzyme B12, Radical Reaction, Ribose Pseudorotation, Tim-Barrel, Rossman-Fold, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. Gruber, R. Reitzer, C. Kratky
Radical Shuttling In A Protein: Ribose Pseudorotation Controls Alkyl-Radical Transfer In The Coenzyme B(12) Dependent Enzyme Glutamate Mutase
Angew. Chem. Int. Ed. Engl. V. 40 3377 2001 (for further references see the PDB file header)

(-) Compounds

Molecule 1 - GLUTAMATE MUTASE
    Atcc: DSM 1285
    Chains: A, C
    Collection: DSM 1285
    EC Number: 5.4.99.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: POZ3
    Expression System Strain: MC4100
    Expression System Taxid: 562
    Gene: GLMS
    Organism Scientific: CLOSTRIDIUM COCHLEARIUM
    Organism Taxid: 1494
    Synonym: METHYLASPARTATE MUTASE SMALL CHAIN
 
Molecule 2 - GLUTAMATE MUTASE
    Atcc: DSM 1285
    Chains: B, D
    Collection: DSM 1285
    EC Number: 5.4.99.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: POZ5
    Expression System Strain: DH5 ALPHA
    Expression System Taxid: 562
    Gene: GLME
    Organism Scientific: CLOSTRIDIUM COCHLEARIUM
    Organism Taxid: 1494
    Other Details: COMPLEXED WITH ADENOSYLCOBALAMAIN AND A MIXTURE OF GLUTAMATE AND 2S,3S-3-METHYLASPARTIC ACID
    Synonym: METHYLASPARTATE MUTASE E CHAIN

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 8)

Asymmetric/Biological Unit (4, 8)
No.NameCountTypeFull Name
12AS2Ligand/Ion(2S,3S)-3-METHYL-ASPARTIC ACID
25AD2Ligand/Ion5'-DEOXYADENOSINE
3B122Ligand/IonCOBALAMIN
4GLU2Mod. Amino AcidGLUTAMIC ACID

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:13 , ASP A:14 , CYS A:15 , HIS A:16 , ALA A:17 , VAL A:18 , GLY A:19 , ILE A:22 , LEU A:23 , SER A:61 , LEU A:63 , TYR A:64 , GLY A:65 , GLY A:91 , GLY A:92 , ASN A:93 , VAL A:95 , VAL A:96 , GLY A:97 , THR A:121 , HOH A:804 , HOH A:806 , HOH A:807 , HOH A:809 , HOH A:814 , HOH A:816 , HOH A:855 , ILE B:95 , ALA B:97 , ARG B:100 , ASN B:123 , PRO B:180 , LEU B:219 , THR B:220 , MET B:294 , GLY B:295 , GLY B:296 , PHE B:297 , HIS B:329 , GLU B:330 , GLY B:333 , ILE B:334 , PHE B:471 , 5AD B:1303 , GLU B:1305 , HOH B:1363BINDING SITE FOR RESIDUE B12 A 800
2AC2SOFTWARESER C:13 , ASP C:14 , CYS C:15 , HIS C:16 , ALA C:17 , VAL C:18 , GLY C:19 , LEU C:23 , SER C:61 , LEU C:63 , TYR C:64 , GLY C:65 , GLY C:91 , GLY C:92 , ASN C:93 , VAL C:95 , VAL C:96 , GLY C:97 , THR C:121 , PRO C:123 , HOH C:801 , HOH C:805 , HOH C:808 , HOH C:809 , HOH C:813 , HOH C:817 , HOH C:833 , ILE D:95 , ALA D:97 , ARG D:100 , ASN D:123 , PRO D:180 , THR D:220 , MET D:294 , GLY D:295 , GLY D:296 , PHE D:297 , HIS D:329 , GLU D:330 , ALA D:331 , GLY D:333 , ILE D:334 , PRO D:410 , PHE D:471 , 5AD D:1304 , GLU D:1306 , 2AS D:1308 , HOH D:1361BINDING SITE FOR RESIDUE B12 C 800
3AC3SOFTWAREB12 A:800 , ARG B:66 , ALA B:67 , GLY B:68 , THR B:94 , ASN B:123 , LYS B:326 , GLU B:330 , ILE B:334 , PRO B:335 , GLU B:1305 , 2AS B:1307 , HOH B:1330 , HOH B:1335 , HOH B:1378 , HOH B:1436BINDING SITE FOR RESIDUE 5AD B 1303
4AC4SOFTWAREB12 C:800 , ARG D:66 , ALA D:67 , GLY D:68 , THR D:94 , ASN D:123 , LYS D:326 , GLU D:330 , ILE D:334 , PRO D:335 , GLU D:1306 , 2AS D:1308 , HOH D:1314 , HOH D:1322 , HOH D:1380 , HOH D:1454BINDING SITE FOR RESIDUE 5AD D 1304
5AC5SOFTWAREB12 A:800 , ARG B:66 , THR B:94 , ARG B:100 , ARG B:149 , HIS B:150 , GLU B:171 , TYR B:177 , TYR B:181 , PHE B:216 , HIS B:291 , 5AD B:1303 , HOH B:1315BINDING SITE FOR RESIDUE GLU B 1305
6AC6SOFTWAREARG B:66 , THR B:94 , ARG B:100 , ARG B:149 , HIS B:150 , GLU B:171 , TYR B:177 , TYR B:181 , PHE B:216 , HIS B:291 , 5AD B:1303 , HOH B:1315BINDING SITE FOR RESIDUE 2AS B 1307
7AC7SOFTWAREB12 C:800 , ARG D:66 , THR D:94 , ARG D:100 , ARG D:149 , HIS D:150 , GLU D:171 , TYR D:177 , TYR D:181 , PHE D:216 , HIS D:291 , 5AD D:1304 , HOH D:1325BINDING SITE FOR RESIDUE GLU D 1306
8AC8SOFTWAREB12 C:800 , ARG D:66 , ARG D:100 , ARG D:149 , HIS D:150 , GLU D:171 , TYR D:177 , TYR D:181 , PHE D:216 , HIS D:291 , 5AD D:1304 , HOH D:1325BINDING SITE FOR RESIDUE 2AS D 1308

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1I9C)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1I9C)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1I9C)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1B12_BINDINGPS51332 B12-binding domain profile.GMSS_CLOCO3-137
 		  2A:3-137
C:3-137

(-) Exons   (0, 0)

(no "Exon" information available for 1I9C)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:137
 aligned with GMSS_CLOCO | P80078 from UniProtKB/Swiss-Prot  Length:137

    Alignment length:137
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       
           GMSS_CLOCO     1 MEKKTIVLGVIGSDCHAVGNKILDHAFTNAGFNVVNIGVLSPQEVFIKAAIETKADAILLSSLYGQGEIDCKGLRQKCDEAGLEGILLYVGGNIVVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDLNIE 137
               SCOP domains d1i9ca_ A: Glutamate mutase, small subunit                                                                                                SCOP domains
               CATH domains 1i9cA00 A:1-137  [code=3.40.50.280, no name defined]                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee.....hhhhhhhhhhhhhh..eeeeeeeeehhhhhhhhhhhhh..eeeeee...hhhhhh.hhhhhhhhh.....eeeeee.......hhhhhhhhhhhh...ee.....hhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --B12_BINDING  PDB: A:3-137 UniProt: 3-137                                                                                                PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1i9c A   1 MEKKTIVLGVIGSDCHAVGNKILDHAFTNAGFNVVNIGVLSPQENFIKAAIETKADAILVSSLYGQGEIDCKGLRQKCDEAGLEGILLYVGGNIVVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDLNIE 137
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       


Chain B from PDB  Type:PROTEIN  Length:483
 aligned with GLME_CLOCO | P80077 from UniProtKB/Swiss-Prot  Length:483

    Alignment length:483
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480   
           GLME_CLOCO     1 MELKNKKWTDEEFHKQREEVLQQWPTGKEVDLQEAVDYLKKIPAEKNFAEKLVLAKKKGITMAQPRAGVALLDEHIELLRYLQDEGGADFLPSTIDAYTRQNRYDECENGIKESEKAGRSLLNGFPGVNYGVKGCRKVLEAVNLPLQARHGTPDSRLLAEIIHAGGWTSNEGGGISYNVPYAKNVTIEKSLLDWQYCDRLVGFYEEQGVHINREPFGPLTGTLVPPSMSNAVGITEALLAAEQGVKNITVGYGECGNMIQDIAALRCLEEQTNEYLKAYGYNDVFVTTVFHQWMGGFPQDESKAFGVIVTATTIAALAGATKVIVKTPHEAIGIPTKEANAAGIKATKMALNMLEGQRMPMSKELETEMAVIKAETKCILDKMFELGKGDLAIGTVKAFETGVMDIPFGPSKYNAGKMMPVRDNLGCVRYLEFGNVPFTEEIKNYNRERLQERAKFEGRDVSFQMVIDDIFAVGKGRLIGRPE 483
               SCOP domains d1i9cb_ B: Glutamate mutase, large subunit                                                                                                                                                                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 1i9cB01 B:1-417  [code=3.20.20.240, no name defined]                                                                                                                                                                                                                                                                                                                                                                             1i9cB02 B:418-483  [code=3.90.970.10, no name defined]             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eee......hhhhhhhhhhhhhhh.....eeee.hhhhhh.hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhh...eee..............hhhhhhhhhhhhhhhhhhhhhh....eee..........hhhhhhhhhhhhhhhhhhh...eeeeeee...hhhhhhhhhhhhhhhhhhhhhhh.....eeeeeee........hhhhhhhhhhhhhhhhhhhh..eee...........hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh................eeee.....eeeee......hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1i9c B   1 MELKNKKWTDEEFHKQREEVLQQWPTGKEVDLQEAVDYLKKIPAEKNFAEKLVLAKKKGITMAQPRAGVALLDEHIELLRYLQDEGGADFLPSTIDAYTRQNRYDECENGIKESEKAGRSLLNGFPGVNFGVKGCRKVLEAVNLPLQARHGTPDSRLLAEIIHAGGWTSNEGGGISYNVPYAKNVTIEKSLLDWQYCDRLVGFYEEQGVHINREPFGPLTGTLVPPSMSNAVGITEALLAAEQGVKNITVGYGECGNMIQDIAALRCLEEQTNEYLKAYGYNDVFVTTVFHQWMGGFPQDESKAFGVIVTATTIAALAGATKVIVKTPHEAIGIPTKEANAAGIKATKMALNMLEGQRMPMSKELETEMAVIKAETKCILDKMFELGKGDLAIGTVKAFETGVMDIPFGPSKYNAGKMMPVRDNLGCVRYLEFGNVPFTEEIKNYNRERLQERAKFEGRDVSFQMVIDDIFAVGKGRLIGRPE 483
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480   


Chain C from PDB  Type:PROTEIN  Length:137
 aligned with GMSS_CLOCO | P80078 from UniProtKB/Swiss-Prot  Length:137

    Alignment length:137
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       
           GMSS_CLOCO     1 MEKKTIVLGVIGSDCHAVGNKILDHAFTNAGFNVVNIGVLSPQEVFIKAAIETKADAILLSSLYGQGEIDCKGLRQKCDEAGLEGILLYVGGNIVVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDLNIE 137
               SCOP domains d1i9cc_ C: Glutamate mutase, small subunit                                                                                                SCOP domains
               CATH domains 1i9cC00 C:1-137  [code=3.40.50.280, no name defined]                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee.....hhhhhhhhhhhhhh..eeeeeeeeehhhhhhhhhhhhh..eeeeee...hhhhhh.hhhhhhhhh.....eeeeee.......hhhhhhhhhhhh...eee....hhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --B12_BINDING  PDB: C:3-137 UniProt: 3-137                                                                                                PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1i9c C   1 MEKKTIVLGVIGSDCHAVGNKILDHAFTNAGFNVVNIGVLSPQENFIKAAIETKADAILVSSLYGQGEIDCKGLRQKCDEAGLEGILLYVGGNIVVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDLNIE 137
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       


Chain D from PDB  Type:PROTEIN  Length:483
 aligned with GLME_CLOCO | P80077 from UniProtKB/Swiss-Prot  Length:483

    Alignment length:483
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480   
           GLME_CLOCO     1 MELKNKKWTDEEFHKQREEVLQQWPTGKEVDLQEAVDYLKKIPAEKNFAEKLVLAKKKGITMAQPRAGVALLDEHIELLRYLQDEGGADFLPSTIDAYTRQNRYDECENGIKESEKAGRSLLNGFPGVNYGVKGCRKVLEAVNLPLQARHGTPDSRLLAEIIHAGGWTSNEGGGISYNVPYAKNVTIEKSLLDWQYCDRLVGFYEEQGVHINREPFGPLTGTLVPPSMSNAVGITEALLAAEQGVKNITVGYGECGNMIQDIAALRCLEEQTNEYLKAYGYNDVFVTTVFHQWMGGFPQDESKAFGVIVTATTIAALAGATKVIVKTPHEAIGIPTKEANAAGIKATKMALNMLEGQRMPMSKELETEMAVIKAETKCILDKMFELGKGDLAIGTVKAFETGVMDIPFGPSKYNAGKMMPVRDNLGCVRYLEFGNVPFTEEIKNYNRERLQERAKFEGRDVSFQMVIDDIFAVGKGRLIGRPE 483
               SCOP domains d1i9cd_ D: Glutamate mutase, large subunit                                                                                                                                                                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 1i9cD01 D:1-417  [code=3.20.20.240, no name defined]                                                                                                                                                                                                                                                                                                                                                                             1i9cD02 D:418-483  [code=3.90.970.10, no name defined]             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eee......hhhhhhhhhhhhhhh.....eeee.hhhhhh.hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhh...eee..............hhhhhhhhhhhhhhhhhhhhhh....eee..........hhhhhhhhhhhhhhhhhhh...eeeeeee...hhhhhhhhhhhhhhhhhhhhhhh.....eeeeeee........hhhhhhhhhhhhhhhhhhhh..eee...........hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh.................eeee.....eeeee......hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1i9c D   1 MELKNKKWTDEEFHKQREEVLQQWPTGKEVDLQEAVDYLKKIPAEKNFAEKLVLAKKKGITMAQPRAGVALLDEHIELLRYLQDEGGADFLPSTIDAYTRQNRYDECENGIKESEKAGRSLLNGFPGVNFGVKGCRKVLEAVNLPLQARHGTPDSRLLAEIIHAGGWTSNEGGGISYNVPYAKNVTIEKSLLDWQYCDRLVGFYEEQGVHINREPFGPLTGTLVPPSMSNAVGITEALLAAEQGVKNITVGYGECGNMIQDIAALRCLEEQTNEYLKAYGYNDVFVTTVFHQWMGGFPQDESKAFGVIVTATTIAALAGATKVIVKTPHEAIGIPTKEANAAGIKATKMALNMLEGQRMPMSKELETEMAVIKAETKCILDKMFELGKGDLAIGTVKAFETGVMDIPFGPSKYNAGKMMPVRDNLGCVRYLEFGNVPFTEEIKNYNRERLQERAKFEGRDVSFQMVIDDIFAVGKGRLIGRPE 483
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (3, 6)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1I9C)

(-) Gene Ontology  (10, 17)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,C   (GMSS_CLOCO | P80078)
molecular function
    GO:0031419    cobalamin binding    Interacting selectively and non-covalently with cobalamin (vitamin B12), a water-soluble vitamin characterized by possession of a corrin nucleus containing a cobalt atom.
    GO:0016866    intramolecular transferase activity    Catalysis of the transfer of a functional group from one position to another within a single molecule.
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0050097    methylaspartate mutase activity    Catalysis of the reaction: threo-3-methyl-L-aspartate = L-glutamate.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0019670    anaerobic glutamate catabolic process    The anaerobic chemical reactions and pathways resulting in the breakdown of glutamate, yielding energy in the form of ATP.
    GO:0019553    glutamate catabolic process via L-citramalate    The chemical reactions and pathways resulting in the breakdown of glutamate, via the intermediate L-citramalate.

Chain B,D   (GLME_CLOCO | P80077)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0031419    cobalamin binding    Interacting selectively and non-covalently with cobalamin (vitamin B12), a water-soluble vitamin characterized by possession of a corrin nucleus containing a cobalt atom.
    GO:0016866    intramolecular transferase activity    Catalysis of the transfer of a functional group from one position to another within a single molecule.
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0050097    methylaspartate mutase activity    Catalysis of the reaction: threo-3-methyl-L-aspartate = L-glutamate.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0019670    anaerobic glutamate catabolic process    The anaerobic chemical reactions and pathways resulting in the breakdown of glutamate, yielding energy in the form of ATP.
    GO:0019553    glutamate catabolic process via L-citramalate    The chemical reactions and pathways resulting in the breakdown of glutamate, via the intermediate L-citramalate.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2AS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    5AD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    B12  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GLU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1i9c)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1i9c
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GLME_CLOCO | P80077
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  GMSS_CLOCO | P80078
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  5.4.99.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GLME_CLOCO | P80077
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  GMSS_CLOCO | P80078
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GLME_CLOCO | P80077: 1cb7 1ccw
        GMSS_CLOCO | P80078: 1b1a 1cb7 1ccw

(-) Related Entries Specified in the PDB File

1cb7 GLUTAMATE MUTASE, RECONSTITUTED WITH METHYLCOBALAMIN
1ccw GLUTAMATE MUTASE, RECONSTITUTED WITH CYANOCOBALAMIN (VITAMIN B12)