Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  GLUTAMATE MUTASE FROM CLOSTRIDIUM COCHLEARIUM RECONSTITUTED WITH METHYL-COBALAMIN
 
Authors :  K. Gruber, R. Reitzer, C. Kratky
Date :  02 Mar 99  (Deposition) - 28 Feb 00  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Glutamate Mutase, Coenzyme-B12, Radical Reaction, Tim-Barrel, Rossman-Fold, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. Reitzer, K. Gruber, G. Jogl, U. G. Wagner, H. Bothe, W. Buckel, C. Kratky
Glutamate Mutase From Clostridium Cochlearium: The Structur Of A Coenzyme B12-Dependent Enzyme Provides New Mechanistic Insights.
Structure Fold. Des. V. 7 891 1999
PubMed-ID: 10467146  |  Reference-DOI: 10.1016/S0969-2126(99)80116-6
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN (GLUTAMATE MUTASE)
    AtccDSM 1285
    ChainsA, C
    CollectionDSM 1285
    EC Number5.4.99.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System GeneGLMS
    Expression System PlasmidPOZ3
    Expression System StrainMC 4100, DH5 ALPHA
    Expression System Taxid562
    GeneGLMS
    Organism ScientificCLOSTRIDIUM COCHLEARIUM
    Organism Taxid1494
    Other DetailsCHAINS A, C, B, D FORM HETEROTETRAMER WHICH IS THE BIOLOGICAL UNIT.
 
Molecule 2 - PROTEIN (GLUTAMATE MUTASE)
    AtccDSM 1285
    ChainsB, D
    CollectionDSM 1285
    EC Number5.4.99.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System GeneGLME
    Expression System PlasmidPOZ5
    Expression System StrainMC 4100, DH5 ALPHA
    Expression System Taxid562
    GeneGLME
    Organism ScientificCLOSTRIDIUM COCHLEARIUM
    Organism Taxid1494
    Other DetailsCOMPLEXED WITH CO-METHYLCOBALAMIN

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric/Biological Unit (2, 4)
No.NameCountTypeFull Name
1COB2Ligand/IonCO-METHYLCOBALAMIN
2TAR2Ligand/IonD(-)-TARTARIC ACID

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:13 , ASP A:14 , CYS A:15 , HIS A:16 , ALA A:17 , VAL A:18 , GLY A:19 , ILE A:22 , LEU A:23 , SER A:61 , LEU A:63 , TYR A:64 , GLY A:65 , GLY A:91 , GLY A:92 , ASN A:93 , VAL A:95 , VAL A:96 , GLY A:97 , THR A:121 , HOH A:804 , HOH A:805 , HOH A:806 , HOH A:812 , HOH A:813 , HOH A:814 , HOH A:818 , HOH A:825 , HOH A:835 , HOH A:863 , THR B:94 , ARG B:100 , PRO B:180 , THR B:220 , MET B:294 , GLY B:295 , GLY B:296 , PHE B:297 , LYS B:326 , HIS B:329 , GLU B:330 , ALA B:331 , GLY B:333 , ILE B:334 , PHE B:471 , TAR B:900 , HOH B:958 , HOH B:1049BINDING SITE FOR RESIDUE COB A 800
2AC2SOFTWARESER C:13 , ASP C:14 , CYS C:15 , HIS C:16 , ALA C:17 , VAL C:18 , SER C:61 , LEU C:63 , TYR C:64 , GLY C:65 , GLY C:91 , GLY C:92 , ASN C:93 , VAL C:95 , VAL C:96 , GLY C:97 , THR C:121 , PRO C:123 , HOH C:804 , HOH C:805 , HOH C:806 , HOH C:807 , HOH C:810 , HOH C:812 , HOH C:823 , HOH C:826 , HOH C:829 , HOH C:834 , THR D:94 , ARG D:100 , PRO D:180 , THR D:220 , MET D:294 , GLY D:295 , GLY D:296 , PHE D:297 , LYS D:326 , HIS D:329 , GLU D:330 , ALA D:331 , GLY D:333 , ILE D:334 , PHE D:471 , TAR D:900 , HOH D:934 , HOH D:1063BINDING SITE FOR RESIDUE COB C 800
3AC3SOFTWARECOB A:800 , ARG B:66 , ARG B:100 , ARG B:149 , HIS B:150 , GLU B:171 , TYR B:177 , TYR B:181 , PHE B:216 , HOH B:902BINDING SITE FOR RESIDUE TAR B 900
4AC4SOFTWARECOB C:800 , ARG D:66 , ARG D:100 , ARG D:149 , HIS D:150 , GLU D:171 , TYR D:177 , TYR D:181 , PHE D:216 , HIS D:291 , HOH D:911BINDING SITE FOR RESIDUE TAR D 900

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1CB7)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1CB7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1CB7)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1B12_BINDINGPS51332 B12-binding domain profile.GMSS_CLOCO3-137
 
  2A:3-137
C:3-137

(-) Exons   (0, 0)

(no "Exon" information available for 1CB7)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:137
 aligned with GMSS_CLOCO | P80078 from UniProtKB/Swiss-Prot  Length:137

    Alignment length:137
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       
           GMSS_CLOCO     1 MEKKTIVLGVIGSDCHAVGNKILDHAFTNAGFNVVNIGVLSPQEVFIKAAIETKADAILLSSLYGQGEIDCKGLRQKCDEAGLEGILLYVGGNIVVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDLNIE 137
               SCOP domains d1cb7a_ A: Glutamate mutase, small subunit                                                                                                SCOP domains
               CATH domains 1cb7A00 A:1-137  [code=3.40.50.280, no name defined]                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee.....hhhhhhhhhhhhhhh.eeeeeeeeehhhhhhhhhhhhh..eeeeee...hhhhhh.hhhhhhhhh.....eeeeee.......hhhhhhhhhhhh...ee.....hhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --B12_BINDING  PDB: A:3-137 UniProt: 3-137                                                                                                PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1cb7 A   1 MEKKTIVLGVIGSDCHAVGNKILDHAFTNAGFNVVNIGVLSPQELFIKAAIETKADAILVSSLYGQGEIDCKGLRQKCDEAGLEGILLYVGGNIVVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDLNIE 137
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       

Chain B from PDB  Type:PROTEIN  Length:483
 aligned with GLME_CLOCO | P80077 from UniProtKB/Swiss-Prot  Length:483

    Alignment length:483
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480   
           GLME_CLOCO     1 MELKNKKWTDEEFHKQREEVLQQWPTGKEVDLQEAVDYLKKIPAEKNFAEKLVLAKKKGITMAQPRAGVALLDEHIELLRYLQDEGGADFLPSTIDAYTRQNRYDECENGIKESEKAGRSLLNGFPGVNYGVKGCRKVLEAVNLPLQARHGTPDSRLLAEIIHAGGWTSNEGGGISYNVPYAKNVTIEKSLLDWQYCDRLVGFYEEQGVHINREPFGPLTGTLVPPSMSNAVGITEALLAAEQGVKNITVGYGECGNMIQDIAALRCLEEQTNEYLKAYGYNDVFVTTVFHQWMGGFPQDESKAFGVIVTATTIAALAGATKVIVKTPHEAIGIPTKEANAAGIKATKMALNMLEGQRMPMSKELETEMAVIKAETKCILDKMFELGKGDLAIGTVKAFETGVMDIPFGPSKYNAGKMMPVRDNLGCVRYLEFGNVPFTEEIKNYNRERLQERAKFEGRDVSFQMVIDDIFAVGKGRLIGRPE 483
               SCOP domains d1cb7b_ B: Glutamate mutase, large subunit                                                                                                                                                                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 1cb7B01 B:1-417  [code=3.20.20.240, no name defined]                                                                                                                                                                                                                                                                                                                                                                             1cb7B02 B:418-483  [code=3.90.970.10, no name defined]             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eee......hhhhhhhhhhhhhhh.....eeee.hhhhhh.hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh....eeee.....hhhhhhhhhhh...eee..............hhhhhhhhhhhhhhhhhhhhhh....eee..........hhhhhhhhhhhhhhhhhhh...eeeeeee...hhhhhhhhhhhhhhhhhhhhhhh.....eeeeeee........hhhhhhhhhhhhhhhhhhhh..eee...........hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh.................eeee.....eeeee......hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1cb7 B   1 MELKNKKWTDEEFHKQREEVLQQWPTGKEVDLQEAVDYLKKIPAEKNFAEKLVLAKKKGITMAQPRAGVALLDEHIELLRYLQDEGGADFLPSTIDAYTRQNRYDECENGIKESEKAGRSLLNGFPGVNFGVKGCRKVLEAVNLPLQARHGTPDSRLLAEIIHAGGWTSNEGGGISYNVPYAKNVTIEKSLLDWQYCDRLVGFYEEQGVHINREPFGPLTGTLVPPSMSNAVGITEALLAAEQGVKNITVGYGECGNMIQDIAALRCLEEQTNEYLKAYGYNDVFVTTVFHQWMGGFPQDESKAFGVIVTATTIAALAGATKVIVKTPHEAIGIPTKEANAAGIKATKMALNMLEGQRMPMSKELETEMAVIKAETKCILDKMFELGKGDLAIGTVKAFETGVMDIPFGPSKYNAGKMMPVRDNLGCVRYLEFGNVPFTEEIKNYNRERLQERAKFEGRDVSFQMVIDDIFAVGKGRLIGRPE 483
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480   

Chain C from PDB  Type:PROTEIN  Length:137
 aligned with GMSS_CLOCO | P80078 from UniProtKB/Swiss-Prot  Length:137

    Alignment length:137
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       
           GMSS_CLOCO     1 MEKKTIVLGVIGSDCHAVGNKILDHAFTNAGFNVVNIGVLSPQEVFIKAAIETKADAILLSSLYGQGEIDCKGLRQKCDEAGLEGILLYVGGNIVVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDLNIE 137
               SCOP domains d1cb7c_ C: Glutamate mutase, small subunit                                                                                                SCOP domains
               CATH domains 1cb7C00 C:1-137  [code=3.40.50.280, no name defined]                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee.....hhhhhhhhhhhhhhh.eeeeeeeeehhhhhhhhhhhhh..eeeeee...hhhhhh.hhhhhhhhh.....eeeeee.......hhhhhhhhhhh....ee.....hhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --B12_BINDING  PDB: C:3-137 UniProt: 3-137                                                                                                PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1cb7 C   1 MEKKTIVLGVIGSDCHAVGNKILDHAFTNAGFNVVNIGVLSPQELFIKAAIETKADAILVSSLYGQGEIDCKGLRQKCDEAGLEGILLYVGGNIVVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDLNIE 137
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       

Chain D from PDB  Type:PROTEIN  Length:483
 aligned with GLME_CLOCO | P80077 from UniProtKB/Swiss-Prot  Length:483

    Alignment length:483
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480   
           GLME_CLOCO     1 MELKNKKWTDEEFHKQREEVLQQWPTGKEVDLQEAVDYLKKIPAEKNFAEKLVLAKKKGITMAQPRAGVALLDEHIELLRYLQDEGGADFLPSTIDAYTRQNRYDECENGIKESEKAGRSLLNGFPGVNYGVKGCRKVLEAVNLPLQARHGTPDSRLLAEIIHAGGWTSNEGGGISYNVPYAKNVTIEKSLLDWQYCDRLVGFYEEQGVHINREPFGPLTGTLVPPSMSNAVGITEALLAAEQGVKNITVGYGECGNMIQDIAALRCLEEQTNEYLKAYGYNDVFVTTVFHQWMGGFPQDESKAFGVIVTATTIAALAGATKVIVKTPHEAIGIPTKEANAAGIKATKMALNMLEGQRMPMSKELETEMAVIKAETKCILDKMFELGKGDLAIGTVKAFETGVMDIPFGPSKYNAGKMMPVRDNLGCVRYLEFGNVPFTEEIKNYNRERLQERAKFEGRDVSFQMVIDDIFAVGKGRLIGRPE 483
               SCOP domains d1cb7d_ D: Glutamate mutase, large subunit                                                                                                                                                                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 1cb7D01 D:1-417  [code=3.20.20.240, no name defined]                                                                                                                                                                                                                                                                                                                                                                             1cb7D02 D:418-483  [code=3.90.970.10, no name defined]             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eee......hhhhhhhhhhhhhhh.....eeee...hhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhh...eee..............hhhhhhhhhhhhhhhhhhhhhh....eee..........hhhhhhhhhhhhhhhhhhh...eeeeeee...hhhhhhhhhhhhhhhhhhhhhhh.....eeeeeee........hhhhhhhhhhhhhhhhhhhh..eee...........hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh.................eeee.....eeeee......hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1cb7 D   1 MELKNKKWTDEEFHKQREEVLQQWPTGKEVDLQEAVDYLKKIPAEKNFAEKLVLAKKKGITMAQPRAGVALLDEHIELLRYLQDEGGADFLPSTIDAYTRQNRYDECENGIKESEKAGRSLLNGFPGVNFGVKGCRKVLEAVNLPLQARHGTPDSRLLAEIIHAGGWTSNEGGGISYNVPYAKNVTIEKSLLDWQYCDRLVGFYEEQGVHINREPFGPLTGTLVPPSMSNAVGITEALLAAEQGVKNITVGYGECGNMIQDIAALRCLEEQTNEYLKAYGYNDVFVTTVFHQWMGGFPQDESKAFGVIVTATTIAALAGATKVIVKTPHEAIGIPTKEANAAGIKATKMALNMLEGQRMPMSKELETEMAVIKAETKCILDKMFELGKGDLAIGTVKAFETGVMDIPFGPSKYNAGKMMPVRDNLGCVRYLEFGNVPFTEEIKNYNRERLQERAKFEGRDVSFQMVIDDIFAVGKGRLIGRPE 483
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (3, 6)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1CB7)

(-) Gene Ontology  (10, 17)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,C   (GMSS_CLOCO | P80078)
molecular function
    GO:0031419    cobalamin binding    Interacting selectively and non-covalently with cobalamin (vitamin B12), a water-soluble vitamin characterized by possession of a corrin nucleus containing a cobalt atom.
    GO:0016866    intramolecular transferase activity    Catalysis of the transfer of a functional group from one position to another within a single molecule.
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0050097    methylaspartate mutase activity    Catalysis of the reaction: threo-3-methyl-L-aspartate = L-glutamate.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0019670    anaerobic glutamate catabolic process    The anaerobic chemical reactions and pathways resulting in the breakdown of glutamate, yielding energy in the form of ATP.
    GO:0019553    glutamate catabolic process via L-citramalate    The chemical reactions and pathways resulting in the breakdown of glutamate, via the intermediate L-citramalate.

Chain B,D   (GLME_CLOCO | P80077)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0031419    cobalamin binding    Interacting selectively and non-covalently with cobalamin (vitamin B12), a water-soluble vitamin characterized by possession of a corrin nucleus containing a cobalt atom.
    GO:0016866    intramolecular transferase activity    Catalysis of the transfer of a functional group from one position to another within a single molecule.
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0050097    methylaspartate mutase activity    Catalysis of the reaction: threo-3-methyl-L-aspartate = L-glutamate.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0019670    anaerobic glutamate catabolic process    The anaerobic chemical reactions and pathways resulting in the breakdown of glutamate, yielding energy in the form of ATP.
    GO:0019553    glutamate catabolic process via L-citramalate    The chemical reactions and pathways resulting in the breakdown of glutamate, via the intermediate L-citramalate.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    COB  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TAR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1cb7)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1cb7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GLME_CLOCO | P80077
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  GMSS_CLOCO | P80078
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  5.4.99.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GLME_CLOCO | P80077
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  GMSS_CLOCO | P80078
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GLME_CLOCO | P800771ccw 1i9c
        GMSS_CLOCO | P800781b1a 1ccw 1i9c

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1CB7)