|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 5)
Asymmetric Unit (4, 5)
|
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1I8O) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1I8O) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1I8O) |
PROSITE Motifs (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1I8O) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:114 aligned with CYC22_RHOPA | P00091 from UniProtKB/Swiss-Prot Length:139 Alignment length:114 35 45 55 65 75 85 95 105 115 125 135 CYC22_RHOPA 26 QDAKAGEAVFKQCMTCHRADKNMVGPALGGVVGRKAGTAAGFTYSPLNHNSGEAGLVWTADNIINYLNDPNAFLKKFLTDKGKADQAVGVTKMTFKLANEQQRKDVVAYLATLK 139 SCOP domains d1i8oa_ A: Cytochrome c2 SCOP domains CATH domains -1i8oA00 A:2-114 Cytochrome c CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE CYTC PDB: A:2-114 UniProt: 26-139 PROSITE Transcript ------------------------------------------------------------------------------------------------------------------ Transcript 1i8o A 1 xDAKAGEAVFKQCMTCHRADKNMVGPALAGVVGRKAGTAAGFTYSPLNHNSGEAGLVWTADNIVPYLADPNAFLKKFLTEKGKADQAVGVTKMTFKLANEQQRKDVVAYLATLK 114 | 10 20 30 40 50 60 70 80 90 100 110 | 1-PCA
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1I8O) |
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A (CYC22_RHOPA | P00091)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|