1HZF - JenaLib

Asymmetric/Biological Unit (7, 7)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.98	ENST00000375177	98	ENSE00001679291	HSCHR6_MHC_SSTO:31974391-31974539	149	CO4B_HUMAN	1-22	22	0	-	-
1.99	ENST00000375177	99	ENSE00001592227	HSCHR6_MHC_SSTO:31974672-31974870	199	CO4B_HUMAN	22-88	67	0	-	-
1.100a	ENST00000375177	100a	ENSE00001633686	HSCHR6_MHC_SSTO:31975085-31975286	202	CO4B_HUMAN	89-156	68	0	-	-
1.101d	ENST00000375177	101d	ENSE00001649954	HSCHR6_MHC_SSTO:31975496-31975566	71	CO4B_HUMAN	156-179	24	0	-	-
1.101h	ENST00000375177	101h	ENSE00001732960	HSCHR6_MHC_SSTO:31975645-31975733	89	CO4B_HUMAN	180-209	30	0	-	-
1.101k	ENST00000375177	101k	ENSE00001752127	HSCHR6_MHC_SSTO:31975952-31976034	83	CO4B_HUMAN	209-237	29	0	-	-
1.102	ENST00000375177	102	ENSE00001621592	HSCHR6_MHC_SSTO:31976205-31976301	97	CO4B_HUMAN	237-269	33	0	-	-
1.103	ENST00000375177	103	ENSE00001764129	HSCHR6_MHC_SSTO:31976440-31976545	106	CO4B_HUMAN	269-304	36	0	-	-
1.104b	ENST00000375177	104b	ENSE00001691554	HSCHR6_MHC_SSTO:31976643-31976775	133	CO4B_HUMAN	305-349	45	0	-	-
1.111a	ENST00000375177	111a	ENSE00001783823	HSCHR6_MHC_SSTO:31983559-31983674	116	CO4B_HUMAN	349-387	39	0	-	-
1.111d	ENST00000375177	111d	ENSE00001675664	HSCHR6_MHC_SSTO:31983774-31983953	180	CO4B_HUMAN	388-447	60	0	-	-
1.112a	ENST00000375177	112a	ENSE00001679195	HSCHR6_MHC_SSTO:31984099-31984281	183	CO4B_HUMAN	448-508	61	0	-	-
1.113b	ENST00000375177	113b	ENSE00001645785	HSCHR6_MHC_SSTO:31984414-31984599	186	CO4B_HUMAN	509-570	62	0	-	-
1.114a	ENST00000375177	114a	ENSE00001759651	HSCHR6_MHC_SSTO:31984753-31984911	159	CO4B_HUMAN	571-623	53	0	-	-
1.115	ENST00000375177	115	ENSE00001728536	HSCHR6_MHC_SSTO:31985163-31985289	127	CO4B_HUMAN	624-666	43	0	-	-
1.116	ENST00000375177	116	ENSE00001774812	HSCHR6_MHC_SSTO:31985457-31985531	75	CO4B_HUMAN	666-691	26	0	-	-
1.117	ENST00000375177	117	ENSE00001746718	HSCHR6_MHC_SSTO:31985792-31985989	198	CO4B_HUMAN	691-757	67	0	-	-
1.118a	ENST00000375177	118a	ENSE00001723324	HSCHR6_MHC_SSTO:31986081-31986192	112	CO4B_HUMAN	757-794	38	0	-	-
1.118c	ENST00000375177	118c	ENSE00001639698	HSCHR6_MHC_SSTO:31986283-31986353	71	CO4B_HUMAN	794-818	25	0	-	-
1.119	ENST00000375177	119	ENSE00001691898	HSCHR6_MHC_SSTO:31986612-31986751	140	CO4B_HUMAN	818-864	47	0	-	-
1.120	ENST00000375177	120	ENSE00001611231	HSCHR6_MHC_SSTO:31986865-31987074	210	CO4B_HUMAN	865-934	70	0	-	-
1.121	ENST00000375177	121	ENSE00001721488	HSCHR6_MHC_SSTO:31987319-31987370	52	CO4B_HUMAN	935-952	18	0	-	-
1.122a	ENST00000375177	122a	ENSE00001718751	HSCHR6_MHC_SSTO:31987472-31987561	90	CO4B_HUMAN	952-982	31	0	-	-
1.123a	ENST00000375177	123a	ENSE00001623042	HSCHR6_MHC_SSTO:31987697-31987906	210	CO4B_HUMAN	982-1052	71	1	A:977-1033	57
1.124	ENST00000375177	124	ENSE00001608111	HSCHR6_MHC_SSTO:31988086-31988161	76	CO4B_HUMAN	1052-1077	26	1	A:1033-1058	26
1.125	ENST00000375177	125	ENSE00001649318	HSCHR6_MHC_SSTO:31988322-31988478	157	CO4B_HUMAN	1077-1129	53	1	A:1058-1110	53
1.126	ENST00000375177	126	ENSE00001674847	HSCHR6_MHC_SSTO:31988574-31988690	117	CO4B_HUMAN	1130-1168	39	1	A:1111-1149	39
1.127	ENST00000375177	127	ENSE00001649290	HSCHR6_MHC_SSTO:31988796-31988967	172	CO4B_HUMAN	1169-1226	58	1	A:1150-1207	58
1.128a	ENST00000375177	128a	ENSE00001605574	HSCHR6_MHC_SSTO:31989196-31989428	233	CO4B_HUMAN	1226-1303	78	1	A:1207-1284 (gaps)	78
1.129	ENST00000375177	129	ENSE00001767709	HSCHR6_MHC_SSTO:31989511-31989678	168	CO4B_HUMAN	1304-1359	56	1	A:1285-1302	18
1.130a	ENST00000375177	130a	ENSE00001601867	HSCHR6_MHC_SSTO:31990072-31990131	60	CO4B_HUMAN	1360-1379	20	0	-	-
1.131b	ENST00000375177	131b	ENSE00001709807	HSCHR6_MHC_SSTO:31991181-31991274	94	CO4B_HUMAN	1380-1411	32	0	-	-
1.132a	ENST00000375177	132a	ENSE00001732532	HSCHR6_MHC_SSTO:31991372-31991558	187	CO4B_HUMAN	1411-1473	63	0	-	-
1.132e	ENST00000375177	132e	ENSE00001662923	HSCHR6_MHC_SSTO:31991673-31991763	91	CO4B_HUMAN	1473-1503	31	0	-	-
1.132g	ENST00000375177	132g	ENSE00001794518	HSCHR6_MHC_SSTO:31991854-31991928	75	CO4B_HUMAN	1504-1528	25	0	-	-
1.136c	ENST00000375177	136c	ENSE00001595537	HSCHR6_MHC_SSTO:31993420-31993522	103	CO4B_HUMAN	1529-1563	35	0	-	-
1.137c	ENST00000375177	137c	ENSE00001783972	HSCHR6_MHC_SSTO:31993688-31993777	90	CO4B_HUMAN	1563-1593	31	0	-	-
1.137e	ENST00000375177	137e	ENSE00001661549	HSCHR6_MHC_SSTO:31993863-31993961	99	CO4B_HUMAN	1593-1626	34	0	-	-
1.137h	ENST00000375177	137h	ENSE00001778876	HSCHR6_MHC_SSTO:31994144-31994227	84	CO4B_HUMAN	1626-1654	29	0	-	-
1.137m	ENST00000375177	137m	ENSE00001727043	HSCHR6_MHC_SSTO:31994490-31994622	133	CO4B_HUMAN	1654-1698	45	0	-	-
1.138b	ENST00000375177	138b	ENSE00001868594	HSCHR6_MHC_SSTO:31994766-31995048	283	CO4B_HUMAN	1698-1744	47	0	-	-

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:302
 aligned with CO4A_HUMAN | P0C0L4 from UniProtKB/Swiss-Prot  Length:1744

    Alignment length:326
                                  1005      1015      1025      1035      1045      1055      1065      1075      1085      1095      1105      1115      1125      1135      1145      1155      1165      1175      1185      1195      1205      1215      1225      1235      1245      1255      1265      1275      1285      1295      1305      1315      
          CO4A_HUMAN    996 SPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHT 1321
               SCOP domains d1hzfa_ A: C4adg fragment of complement factor C4a                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 1hzfA00 A:977-1302  [code=1.50.10.20, no name defined]                                                                                                                                                                                                                                                                                 CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh................hhhhhhhhh..hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhh..ee....ee..------------------------..hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) -----------------------------------------------------------------------------D------------------------------------------------------------------------------------------------------N------------------------S-----A--L---------------------------------------------------------------------------A------------------------------F---- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------G------------------------------------------------------------------------------------------------------S------------------------------V--R--------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE -----------ALPHA_2_M------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1hzf A  977 SPGGVASLLRLPRGCGEQTmIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSmQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKASSFLGEKASAGLLGAHAAAITAYALTLTKAPADLRGVAHNNLmAmAQETGDNLYWG------------------------QAPALWIETTAYALLHLLLHEGKAEmADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHT 1302
                                   986       996      1006      1016      1026      1036      1046      1056      1066      1076      1086      1096      1106  |   1116      1126      1136      1146      1156      1166      1176      1186      1196  | | 1206     |   -         -         -|     1246      1256     |1266      1276      1286      1296      
                                             996-MSE                                                                                                         1109-MSE                                                                                  1199-MSE     1212                     1237                     1262-MSE                                    
                                                                                                                                                                                                                                                         1201-MSE

Chain A from PDB  Type:PROTEIN  Length:302
 aligned with CO4B_HUMAN | P0C0L5 from UniProtKB/Swiss-Prot  Length:1744

    Alignment length:326
                                  1005      1015      1025      1035      1045      1055      1065      1075      1085      1095      1105      1115      1125      1135      1145      1155      1165      1175      1185      1195      1205      1215      1225      1235      1245      1255      1265      1275      1285      1295      1305      1315      
          CO4B_HUMAN    996 SPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRGSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDLSPVIHRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKASSFLGEKASAGLLGAHAAAITAYALTLTKAPADLRGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQAAAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHT 1321
               SCOP domains d1hzfa_ A: C4adg fragment of complement factor C4a                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 1hzfA00 A:977-1302  [code=1.50.10.20, no name defined]                                                                                                                                                                                                                                                                                 CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh................hhhhhhhhh..hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhh..ee....ee..------------------------..hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) -----------------------------------------------------------------------------D------------------------------------------------------------------------------------------------------N------------------------S-----A--L---------------------------------------------------------------------------A------------------------------F---- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------G------------------------------------------------------------------------------------------------------S------------------------------V--R--------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                PROSITE (2) -----------ALPHA_2_M------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
           Transcript 1 (1) Exon 1.123a  PDB: A:977-1033 UniProt: 982-1052           ------------------------Exon 1.125  PDB: A:1058-1110 UniProt: 1077-1129      Exon 1.126  PDB: A:1111-1149           Exon 1.127  PDB: A:1150-1207 UniProt: 1169-1226           -----------------------------------------------------------------------------Exon 1.129         Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------Exon 1.124                ----------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.128a  PDB: A:1207-1284 (gaps) UniProt: 1226-1303                       ------------------ Transcript 1 (2)
                1hzf A  977 SPGGVASLLRLPRGCGEQTmIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSmQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKASSFLGEKASAGLLGAHAAAITAYALTLTKAPADLRGVAHNNLmAmAQETGDNLYWG------------------------QAPALWIETTAYALLHLLLHEGKAEmADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHT 1302
                                   986       996      1006      1016      1026      1036      1046      1056      1066      1076      1086      1096      1106  |   1116      1126      1136      1146      1156      1166      1176      1186      1196  | | 1206     |   -         -         -|     1246      1256     |1266      1276      1286      1296      
                                             996-MSE                                                                                                         1109-MSE                                                                                  1199-MSE     1212                     1237                     1262-MSE                                    
                                                                                                                                                                                                                                                         1201-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (22, 38)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (CO4A_HUMAN | P0C0L4)

molecular function
	GO:0001849	complement component C1q binding	Interacting selectively and non-covalently with the C1q component of the classical complement cascade.
	GO:0004866	endopeptidase inhibitor activity	Stops, prevents or reduces the activity of an endopeptidase, any enzyme that hydrolyzes nonterminal peptide bonds in polypeptides.
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
	GO:0006956	complement activation	Any process involved in the activation of any of the steps of the complement cascade, which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes; the initial steps of complement activation involve one of three pathways, the classical pathway, the alternative pathway, and the lectin pathway, all of which lead to the terminal complement pathway.
	GO:0006958	complement activation, classical pathway	Any process involved in the activation of any of the steps of the classical pathway of the complement cascade which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0006954	inflammatory response	The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0010951	negative regulation of endopeptidase activity	Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
	GO:2000427	positive regulation of apoptotic cell clearance	Any process that activates or increases the frequency, rate or extent of apoptotic cell clearance.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0030449	regulation of complement activation	Any process that modulates the frequency, rate or extent of complement activation.
cellular component
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain A (CO4B_HUMAN | P0C0L5)

molecular function
	GO:0030246	carbohydrate binding	Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
	GO:0001848	complement binding	Interacting selectively and non-covalently with any component or product of the complement cascade.
	GO:0004866	endopeptidase inhibitor activity	Stops, prevents or reduces the activity of an endopeptidase, any enzyme that hydrolyzes nonterminal peptide bonds in polypeptides.
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
	GO:0006956	complement activation	Any process involved in the activation of any of the steps of the complement cascade, which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes; the initial steps of complement activation involve one of three pathways, the classical pathway, the alternative pathway, and the lectin pathway, all of which lead to the terminal complement pathway.
	GO:0006958	complement activation, classical pathway	Any process involved in the activation of any of the steps of the classical pathway of the complement cascade which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes.
	GO:0032490	detection of molecule of bacterial origin	The series of events in which a stimulus from a molecule of bacterial origin is received and converted into a molecular signal.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0006954	inflammatory response	The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0010951	negative regulation of endopeptidase activity	Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
	GO:0008228	opsonization	The process in which a microorganism (or other particulate material) is rendered more susceptible to phagocytosis by coating with an opsonin, a blood serum protein such as a complement component or antibody.
	GO:2000427	positive regulation of apoptotic cell clearance	Any process that activates or increases the frequency, rate or extent of apoptotic cell clearance.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0030449	regulation of complement activation	Any process that modulates the frequency, rate or extent of complement activation.
cellular component
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0044216	other organism cell	A cell of a secondary organism with which the first organism is interacting.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 5)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (11, 11)

PROSITE Motifs (1, 1)

Exons (7, 7)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (22, 38)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File