Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  OXIDISED SOXAX COMPLEX FROM RHODOVULUM SULFIDOPHILUM
 
Authors :  V. A. Bamford, S. Bruno, T. Rasmussen, C. Appia-Ayme, M. R. Cheesman, B. C. Berks, A. M. Hemmings
Date :  21 Aug 02  (Deposition) - 07 Nov 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.75
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Electron Transfer, Sulfur Cycle, Soxax Complex, Thiosulfate Oxidation, Cysteine Persulfide Heme Ligand, Cytochrome C (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  V. A. Bamford, S. Bruno, T. Rasmussen, C. Appia-Ayme, M. R. Cheesman, B. C. Berks, A. M. Hemmings
Structural Basis For The Oxidation Of Thiosulfate By A Sulfur Cycle Enzyme
Embo J. V. 21 5599 2002
PubMed-ID: 12411478  |  Reference-DOI: 10.1093/EMBOJ/CDF566

(-) Compounds

Molecule 1 - DIHEME CYTOCHROME C
    Chains: A
    Organism Scientific: RHODOVULUM SULFIDOPHILUM
    Organism Taxid: 35806
    Synonym: SOXA
 
Molecule 2 - CYTOCHROME C
    Chains: B
    Organism Scientific: RHODOVULUM SULFIDOPHILUM
    Organism Taxid: 35806
    Synonym: SOXX

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric/Biological Unit (2, 4)
No.NameCountTypeFull Name
1CSS1Mod. Amino AcidS-MERCAPTOCYSTEINE
2HEC3Ligand/IonHEME C

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREALA A:75 , CYS A:76 , CYS A:79 , HIS A:80 , LEU A:90 , TYR A:94 , SER A:100 , CYS A:114 , ARG A:118 , MET A:119 , HOH A:2266 , HOH A:2267 , PHE B:56BINDING SITE FOR RESIDUE HEC A1262
2AC2SOFTWAREGLY A:34 , ARG A:38 , SER A:176 , CYS A:177 , CYS A:180 , HIS A:181 , ILE A:189 , HIS A:193 , SER A:195 , GLY A:197 , GLN A:198 , ILE A:199 , PHE A:202 , ARG A:218 , PHE A:219 , CSS A:222 , ARG A:260 , HOH A:2218 , HOH A:2268 , HOH A:2269 , HOH A:2270BINDING SITE FOR RESIDUE HEC A1263
3AC3SOFTWAREGLY B:40 , CYS B:42 , CYS B:45 , HIS B:46 , PRO B:62 , LEU B:64 , ARG B:70 , TYR B:71 , ILE B:79 , LEU B:80 , PHE B:87 , THR B:90 , VAL B:91 , MET B:92 , TYR B:95 , VAL B:129 , HOH B:2082 , HOH B:2083BINDING SITE FOR RESIDUE HEC B1138

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1H33)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1Tyr A:94 -Pro A:95
2Phe A:202 -Pro A:203
3Gly A:256 -Pro A:257

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1H33)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYTCPS51007 Cytochrome c family profile.SOXA_RHOSU74-168  1A:48-142

(-) Exons   (0, 0)

(no "Exon" information available for 1H33)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:261
 aligned with SOXA_RHOSU | Q939U1 from UniProtKB/Swiss-Prot  Length:287

    Alignment length:261
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286 
           SOXA_RHOSU    27 GPDDPLVINGEIEIVTRAPTPAHLADRFDEIRSGWTFRTDDTQALEMDDFENSGMVFVEEARAVWDRPEGTEGKACADCHGAVDDGMYGLRAVYPKYVESAGKVRTVEQMINACRTSRMGAPEWDYIGPDMTAMVALIASVSRGMPVSVAIDGPAQSTWEKGREIYYTRYGQLDLSCASCHEQYFDHYIRADHLSQGQINGFPSYRLKNARLNAVHDRFRGCIRDTRGVPFAVGSPEFVALELYVASRGNGLSVEGPSVRN 287
               SCOP domains d1h33a1 A:1-150 Di-heme cytochrome c SoxA                                                                                                             d1h33a2 A:151-261 Di-heme cytochrome c SoxA                                                                     SCOP domains
               CATH domains 1h33A01 A:1-54,A:146-260 Cytochrome c                 1h33A02 A:55-142 Cytochrome c                                                           ---1h33A01 A:1-54,A:146-260 Cytochrome c                                                                              - CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee...eee..ee..hhhhh.....ee.hhhhhhhhhhhhh......hhhhhhhhhhhhhh........hhhhhhhhhhhhh.hhhhhh.ee.hhhh.eehhhhhhhhhhhhh.........hhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhh........hhhhhhh.....ee..ee..........eee....eeehhhhhhhhhhhh.........hhhhhhhhhhhhhh.........eee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------CYTC  PDB: A:48-142 UniProt: 74-168                                                            ----------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1h33 A   1 GPDDPLVINGEIEIVTRAPTPAHLADRFDEIRSGWTFRTDDTQALEMDDFENSGMVFVEEARAVWDRPEGTEGKACADCHGAVDDGMYGLRAVYPKYVESAGKVRTVEQMINACRTSRMGAPEWDYIGPDMTAMVALIASVSRGMPVSVAIDGPAQSTWEKGREIYYTRYGQLDLSCASCHEQYFDHYIRADHLSQGQINGFPSYRLKNARLNAVHDRFRGcIRDTRGVPFAVGSPEFVALELYVASRGNGLSVEGPSVRN 261
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220 |     230       240       250       260 
                                                                                                                                                                                                                                                       222-CSS                                   


Chain B from PDB  Type:PROTEIN  Length:135
 aligned with Q939U4_RHOSU | Q939U4 from UniProtKB/TrEMBL  Length:160

    Alignment length:138
                                    32        42        52        62        72        82        92       102       112       122       132       142       152        
         Q939U4_RHOSU    23 AEVAPGDVAIDGQGHVARPLTDAPGDPVEGRRLMTDRSVGNCIACHEVTEMADAQFPGTVGPSLDGVAARYPEAMIRGILVNSKNVFPETVMPAYYRVEGFNRPGIAFTSKPIEGEIRPLMTAGQIEDVVAYLMTLTQ 160
               SCOP domains d1h33b_ B: Mono-heme c-type cytochrome SoxX                                                                                                SCOP domains
               CATH domains 1h33B00 B:1-138 Cytochrome c                                                                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhh.................hhhhhhhhhhh....hhhhh......---...........hhhhhhhhhhhhhhhhhhhhhh..................................hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1h33 B   1 AEVAPGDVAIDGQGHVARPLTDAPGDPVEGRRLMTDRSVGNCIACHEVTEM---QFPGTVGPSLDGVAARYPEAMIRGILVNSKNVFPETVMPAYYRVEGFNRPGIAFTSKPIEGEIRPLMTAGQIEDVVAYLMTLTQ 138
                                    10        20        30        40        50|   |   60        70        80        90       100       110       120       130        
                                                                             51  55
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 3)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1H33)

(-) Gene Ontology  (14, 18)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (SOXA_RHOSU | Q939U1)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016669    oxidoreductase activity, acting on a sulfur group of donors, cytochrome as acceptor    Catalysis of an oxidation-reduction (redox) reaction in which a sulfur-containing group acts as a hydrogen or electron donor and reduces a cytochrome.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
    GO:0016783    sulfurtransferase activity    Catalysis of the transfer of sulfur atoms from one compound (donor) to another (acceptor).
biological process
    GO:0018192    enzyme active site formation via cysteine modification to L-cysteine persulfide    The formation of an enzyme active site via modification of peptidyl-cysteine to peptidyl-L-cysteine persulfide.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0019418    sulfide oxidation    The chemical reactions and pathways resulting in the conversion of sulfide to elemental sulfur in a higher oxidation state, or to sulfite or sulfate.
    GO:0019417    sulfur oxidation    The chemical reactions and pathways resulting the addition of oxygen to elemental sulfur.
cellular component
    GO:0070069    cytochrome complex    A protein complex in which at least one of the proteins is a cytochrome, i.e. a heme-containing protein involved in catalysis of redox reactions.
    GO:0042597    periplasmic space    The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

Chain B   (Q939U4_RHOSU | Q939U4)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CSS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HEC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:256 - Pro A:257   [ RasMol ]  
    Phe A:202 - Pro A:203   [ RasMol ]  
    Tyr A:94 - Pro A:95   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1h33
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q939U4_RHOSU | Q939U4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  SOXA_RHOSU | Q939U1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q939U4_RHOSU | Q939U4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SOXA_RHOSU | Q939U1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SOXA_RHOSU | Q939U1: 1h31 1h32 2oz1
UniProtKB/TrEMBL
        Q939U4_RHOSU | Q939U4: 1h31 1h32 2oz1

(-) Related Entries Specified in the PDB File

1h31 OXIDISED SOXAX COMPLEX FROM RHODOVULUM SULFIDOPHILUM
1h32 REDUCED SOXAX COMPLEX FROM RHODOVULUM SULFIDOPHILUM