1GXD - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   PROMMP-2/TIMP-2 COMPLEX

Authors :   E. Morgunova, A. Tuuttila, U. Bergmann, K. Tryggvason

Date :   02 Apr 02 (Deposition) - 09 Jul 02 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.10

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,C  (1x)
Biol. Unit 2: B,D  (1x)

Keywords :   Hydrolase, Metalloprotease, Zymogen, Collagen Degradation, Extracellular Matrix, Gelatinase A, Matrix Metalloproteinase 2, Proteinase Inhibitor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   E. Morgunova, A. Tuuttila, U. Bergmann, K. Tryggvason
Structural Insight Into The Complex Formation Of Latent Matrix Metalloproteinase 2 With Tissue Inhibitor Of Metalloproteinase 2
Proc. Natl. Acad. Sci. Usa V. 99 7414 2002
PubMed-ID: 12032297 | Reference-DOI: 10.1073/PNAS.102185399

Molecule 1 - 72 KDA TYPE IV COLLAGENASE
	Chains	:	A, B
	EC Number	:	3.4.24.24
	Engineered	:	YES
	Expression System	:	TRICHOPLUSIA NI
	Expression System Cell Line	:	H5
	Expression System Plasmid	:	PVL1393
	Expression System Taxid	:	7111
	Expression System Vector Type	:	BACULOVIRUS
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	GELATINASE A, 72 KDA GELATINASE, MATRIX METALLOPROTEINASE-2, MMP-2, TBE-1

Molecule 2 - METALLOPROTEINASE INHIBITOR 2
	Chains	:	C, D
	Engineered	:	YES
	Expression System	:	TRICHOPLUSIA NI
	Expression System Cell Line	:	H5
	Expression System Plasmid	:	PVL1393
	Expression System Taxid	:	7111
	Expression System Vector	:	BACULOVIRUS
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TISSUE INHIBITOR OF METALLOPROTEINASES-2, TIMP-2

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A		C
Biological Unit 2 (1x)	:		B		D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 8)

No.	Name	Count	Type	Full Name
1	CA	2	Ligand/Ion	CALCIUM ION
2	SO4	2	Ligand/Ion	SULFATE ION
3	ZN	4	Ligand/Ion	ZINC ION

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION
2	SO4	1	Ligand/Ion	SULFATE ION
3	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION
2	SO4	1	Ligand/Ion	SULFATE ION
3	ZN	-1	Ligand/Ion	ZINC ION

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLN A:269 , GLY A:270 , THR A:271 , THR B:278	BINDING SITE FOR RESIDUE SO4 A1632
2	AC2	SOFTWARE	HIS A:149 , ASP A:151 , HIS A:164 , HIS A:177	BINDING SITE FOR RESIDUE ZN A1633
3	AC3	SOFTWARE	CYS A:73 , ASN A:75 , HIS A:374 , HIS A:378 , HIS A:384	BINDING SITE FOR RESIDUE ZN A1634
4	AC4	SOFTWARE	ASP A:156 , GLY A:157 , ASP A:159 , LEU A:161 , ASP A:179 , GLU A:182	BINDING SITE FOR RESIDUE CA A1635
5	AC5	SOFTWARE	THR A:278 , GLN B:269 , GLY B:270 , THR B:271	BINDING SITE FOR RESIDUE SO4 B1632
6	AC6	SOFTWARE	HIS B:149 , ASP B:151 , HIS B:164 , HIS B:177	BINDING SITE FOR RESIDUE ZN B1633
7	AC7	SOFTWARE	CYS B:73 , ASN B:75 , HIS B:374 , HIS B:378 , HIS B:384	BINDING SITE FOR RESIDUE ZN B1634
8	AC8	SOFTWARE	ASP B:156 , GLY B:157 , ASP B:159 , LEU B:161 , ASP B:179 , GLU B:182	BINDING SITE FOR RESIDUE CA B1635

Asymmetric Unit

No.	Residues
1	A:31	-	A:36
2	A:204	-	A:230
3	A:218	-	A:245
4	A:262	-	A:288
5	A:276	-	A:303
6	A:320	-	A:346
7	A:334	-	A:361
8	A:440	-	A:631
9	B:31	-	B:36
10	B:204	-	B:230
11	B:218	-	B:245
12	B:262	-	B:288
13	B:276	-	B:303
14	B:320	-	B:346
15	B:334	-	B:361
16	B:440	-	B:631
17	C:1	-	C:72
18	C:3	-	C:101
19	C:13	-	C:126
20	C:128	-	C:175
21	C:133	-	C:138
22	C:146	-	C:167
23	D:1	-	D:72
24	D:3	-	D:101
25	D:13	-	D:126
26	D:128	-	D:167
27	D:128	-	D:175
28	D:133	-	D:138
29	D:146	-	D:167

Asymmetric Unit

No.	Residues
1	Phe A:206	-	Pro A:207
2	Phe A:264	-	Pro A:265
3	Phe A:322	-	Pro A:323
4	Gly A:476	-	Pro A:477
5	Tyr A:523	-	Pro A:524
6	Phe A:573	-	Pro A:574
7	Phe B:206	-	Pro B:207
8	Phe B:264	-	Pro B:265
9	Phe B:322	-	Pro B:323
10	Gly B:476	-	Pro B:477
11	Tyr B:523	-	Pro B:524
12	Phe B:573	-	Pro B:574
13	Ile C:136	-	Pro C:137
14	Ile D:136	-	Pro D:137

Asymmetric Unit (11, 22)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_032423	R	101	H	MMP2_HUMAN	Disease (MONA)	121912953	A/B	R	72	H
02	UniProt	VAR_032424	D	210	Y	MMP2_HUMAN	Polymorphism	---	A/B	D	181	Y
03	UniProt	VAR_036136	A	228	T	MMP2_HUMAN	Unclassified	759302357	A/B	A	199	T
04	CancerSNP	VAR_MMP2_HUMAN_CCDS10752_1_01 *	A	228	T	MMP2_HUMAN	Disease (Colorectal cancer)	---	A/B	A	199	T
05	UniProt	VAR_032425	E	404	K	MMP2_HUMAN	Disease (MONA)	121912955	A/B	A	375	K
06	UniProt	VAR_020616	A	447	V	MMP2_HUMAN	Polymorphism	17859943	A/B	A	418	V
07	UniProt	VAR_036137	T	498	M	MMP2_HUMAN	Unclassified	764961297	A/B	T	469	M
08	CancerSNP	VAR_MMP2_HUMAN_CCDS10752_1_02 *	T	498	M	MMP2_HUMAN	Disease (Colorectal cancer)	---	A/B	T	469	M
09	UniProt	VAR_020617	V	621	L	MMP2_HUMAN	Polymorphism	16955280	A/B	V	592	L
10	UniProt	VAR_036138	S	644	I	MMP2_HUMAN	Unclassified	---	A/B	S	615	I
11	CancerSNP	VAR_MMP2_HUMAN_CCDS10752_1_03 *	S	644	I	MMP2_HUMAN	Disease (Colorectal cancer)	---	A/B	S	615	I
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (11, 11)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_032423	R	101	H	MMP2_HUMAN	Disease (MONA)	121912953	A	R	72	H
02	UniProt	VAR_032424	D	210	Y	MMP2_HUMAN	Polymorphism	---	A	D	181	Y
03	UniProt	VAR_036136	A	228	T	MMP2_HUMAN	Unclassified	759302357	A	A	199	T
04	CancerSNP	VAR_MMP2_HUMAN_CCDS10752_1_01 *	A	228	T	MMP2_HUMAN	Disease (Colorectal cancer)	---	A	A	199	T
05	UniProt	VAR_032425	E	404	K	MMP2_HUMAN	Disease (MONA)	121912955	A	A	375	K
06	UniProt	VAR_020616	A	447	V	MMP2_HUMAN	Polymorphism	17859943	A	A	418	V
07	UniProt	VAR_036137	T	498	M	MMP2_HUMAN	Unclassified	764961297	A	T	469	M
08	CancerSNP	VAR_MMP2_HUMAN_CCDS10752_1_02 *	T	498	M	MMP2_HUMAN	Disease (Colorectal cancer)	---	A	T	469	M
09	UniProt	VAR_020617	V	621	L	MMP2_HUMAN	Polymorphism	16955280	A	V	592	L
10	UniProt	VAR_036138	S	644	I	MMP2_HUMAN	Unclassified	---	A	S	615	I
11	CancerSNP	VAR_MMP2_HUMAN_CCDS10752_1_03 *	S	644	I	MMP2_HUMAN	Disease (Colorectal cancer)	---	A	S	615	I
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (11, 11)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_032423	R	101	H	MMP2_HUMAN	Disease (MONA)	121912953	B	R	72	H
02	UniProt	VAR_032424	D	210	Y	MMP2_HUMAN	Polymorphism	---	B	D	181	Y
03	UniProt	VAR_036136	A	228	T	MMP2_HUMAN	Unclassified	759302357	B	A	199	T
04	CancerSNP	VAR_MMP2_HUMAN_CCDS10752_1_01 *	A	228	T	MMP2_HUMAN	Disease (Colorectal cancer)	---	B	A	199	T
05	UniProt	VAR_032425	E	404	K	MMP2_HUMAN	Disease (MONA)	121912955	B	A	375	K
06	UniProt	VAR_020616	A	447	V	MMP2_HUMAN	Polymorphism	17859943	B	A	418	V
07	UniProt	VAR_036137	T	498	M	MMP2_HUMAN	Unclassified	764961297	B	T	469	M
08	CancerSNP	VAR_MMP2_HUMAN_CCDS10752_1_02 *	T	498	M	MMP2_HUMAN	Disease (Colorectal cancer)	---	B	T	469	M
09	UniProt	VAR_020617	V	621	L	MMP2_HUMAN	Polymorphism	16955280	B	V	592	L
10	UniProt	VAR_036138	S	644	I	MMP2_HUMAN	Unclassified	---	B	S	615	I
11	CancerSNP	VAR_MMP2_HUMAN_CCDS10752_1_03 *	S	644	I	MMP2_HUMAN	Disease (Colorectal cancer)	---	B	S	615	I
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (8, 30)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	NTR	PS50189	NTR domain profile.	TIMP2_HUMAN	27-152	2	C:1-126 D:1-126
2	TIMP	PS00288	Tissue inhibitors of metalloproteinases signature.	TIMP2_HUMAN	27-39	2	C:1-13 D:1-13
3	CYSTEINE_SWITCH	PS00546	Matrixins cysteine switch.	MMP2_HUMAN	100-107	2	A:71-78 B:71-78
4	FN2_2	PS51092	Fibronectin type-II collagen-binding domain profile.	MMP2_HUMAN	228-276 286-334 344-392	6	A:199-247 B:199-247 A:257-305 B:257-305 A:315-363 B:315-363
5	FN2_1	PS00023	Fibronectin type-II collagen-binding domain signature.	MMP2_HUMAN	233-274 291-332 349-390	6	A:204-245 B:204-245 A:262-303 B:262-303 A:320-361 B:320-361
6	ZINC_PROTEASE	PS00142	Neutral zinc metallopeptidases, zinc-binding region signature.	MMP2_HUMAN	400-409	2	A:371-380 B:371-380
7	HEMOPEXIN_2	PS51642	Hemopexin repeat profile.	MMP2_HUMAN	472-516 517-563 565-613 614-660	8	A:443-487 B:443-487 A:488-534 B:488-534 A:536-584 B:536-584 A:585-631 B:585-631
8	HEMOPEXIN	PS00024	Hemopexin domain signature.	MMP2_HUMAN	606-621	2	A:577-592 B:577-592

Biological Unit 1 (8, 15)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	NTR	PS50189	NTR domain profile.	TIMP2_HUMAN	27-152	1	C:1-126 -
2	TIMP	PS00288	Tissue inhibitors of metalloproteinases signature.	TIMP2_HUMAN	27-39	1	C:1-13 -
3	CYSTEINE_SWITCH	PS00546	Matrixins cysteine switch.	MMP2_HUMAN	100-107	1	A:71-78 -
4	FN2_2	PS51092	Fibronectin type-II collagen-binding domain profile.	MMP2_HUMAN	228-276 286-334 344-392	3	A:199-247 - A:257-305 - A:315-363 -
5	FN2_1	PS00023	Fibronectin type-II collagen-binding domain signature.	MMP2_HUMAN	233-274 291-332 349-390	3	A:204-245 - A:262-303 - A:320-361 -
6	ZINC_PROTEASE	PS00142	Neutral zinc metallopeptidases, zinc-binding region signature.	MMP2_HUMAN	400-409	1	A:371-380 -
7	HEMOPEXIN_2	PS51642	Hemopexin repeat profile.	MMP2_HUMAN	472-516 517-563 565-613 614-660	4	A:443-487 - A:488-534 - A:536-584 - A:585-631 -
8	HEMOPEXIN	PS00024	Hemopexin domain signature.	MMP2_HUMAN	606-621	1	A:577-592 -

Biological Unit 2 (8, 15)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	NTR	PS50189	NTR domain profile.	TIMP2_HUMAN	27-152	1	- D:1-126
2	TIMP	PS00288	Tissue inhibitors of metalloproteinases signature.	TIMP2_HUMAN	27-39	1	- D:1-13
3	CYSTEINE_SWITCH	PS00546	Matrixins cysteine switch.	MMP2_HUMAN	100-107	1	- B:71-78
4	FN2_2	PS51092	Fibronectin type-II collagen-binding domain profile.	MMP2_HUMAN	228-276 286-334 344-392	3	- B:199-247 - B:257-305 - B:315-363
5	FN2_1	PS00023	Fibronectin type-II collagen-binding domain signature.	MMP2_HUMAN	233-274 291-332 349-390	3	- B:204-245 - B:262-303 - B:320-361
6	ZINC_PROTEASE	PS00142	Neutral zinc metallopeptidases, zinc-binding region signature.	MMP2_HUMAN	400-409	1	- B:371-380
7	HEMOPEXIN_2	PS51642	Hemopexin repeat profile.	MMP2_HUMAN	472-516 517-563 565-613 614-660	4	- B:443-487 - B:488-534 - B:536-584 - B:585-631
8	HEMOPEXIN	PS00024	Hemopexin domain signature.	MMP2_HUMAN	606-621	1	- B:577-592

Asymmetric Unit (18, 36)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000219070	1	ENSE00001045278	chr16:55512883-55513544	662	MMP2_HUMAN	1-51	51	2	A:1-22 B:2-22	22 21
1.3	ENST00000219070	3	ENSE00000684353	chr16:55516821-55517047	227	MMP2_HUMAN	52-127	76	2	A:23-98 B:23-98	76 76
1.4	ENST00000219070	4	ENSE00000684376	chr16:55517928-55518076	149	MMP2_HUMAN	127-177	51	2	A:98-148 B:98-148	51 51
1.5	ENST00000219070	5	ENSE00000684379	chr16:55519211-55519339	129	MMP2_HUMAN	177-220	44	2	A:148-191 B:148-191	44 44
1.6	ENST00000219070	6	ENSE00000684383	chr16:55519516-55519689	174	MMP2_HUMAN	220-278	59	2	A:191-249 B:191-249	59 59
1.7	ENST00000219070	7	ENSE00000396666	chr16:55522455-55522628	174	MMP2_HUMAN	278-336	59	2	A:249-307 B:249-307	59 59
1.8	ENST00000219070	8	ENSE00000684389	chr16:55523563-55523736	174	MMP2_HUMAN	336-394	59	2	A:307-365 B:307-365	59 59
1.9	ENST00000219070	9	ENSE00001170187	chr16:55525713-55525868	156	MMP2_HUMAN	394-446	53	2	A:365-417 B:365-417	53 53
1.10	ENST00000219070	10	ENSE00000684415	chr16:55527070-55527205	136	MMP2_HUMAN	446-491	46	2	A:417-462 (gaps) B:417-462 (gaps)	46 46
1.11	ENST00000219070	11	ENSE00000684425	chr16:55530838-55530974	137	MMP2_HUMAN	491-537	47	2	A:462-508 B:462-508	47 47
1.12	ENST00000219070	12	ENSE00000684426	chr16:55532201-55532360	160	MMP2_HUMAN	537-590	54	2	A:508-561 B:508-561	54 54
1.13	ENST00000219070	13	ENSE00000684427	chr16:55536691-55536800	110	MMP2_HUMAN	590-627	38	2	A:561-598 B:561-598	38 38
1.14b	ENST00000219070	14b	ENSE00001931477	chr16:55539251-55540603	1353	MMP2_HUMAN	627-660	34	2	A:598-631 B:598-631	34 34

2.1	ENST00000262768	1	ENSE00001319888	chr17:76921469-76921041	429	TIMP2_HUMAN	1-44	44	2	C:1-18 D:1-18	18 18
2.2b	ENST00000262768	2b	ENSE00001298704	chr17:76870001-76869901	101	TIMP2_HUMAN	44-77	34	2	C:18-51 D:18-51	34 34
2.3	ENST00000262768	3	ENSE00000745851	chr17:76867088-76866980	109	TIMP2_HUMAN	78-114	37	2	C:52-88 D:52-88	37 37
2.4a	ENST00000262768	4a	ENSE00001033832	chr17:76853728-76853604	125	TIMP2_HUMAN	114-155	42	2	C:88-129 D:88-129	42 42
2.5b	ENST00000262768	5b	ENSE00001317697	chr17:76851946-76849059	2888	TIMP2_HUMAN	156-220	65	2	C:130-192 D:130-192	63 63

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:624
 aligned with MMP2_HUMAN | P08253 from UniProtKB/Swiss-Prot  Length:660

    Alignment length:631
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       579       589       599       609       619       629       639       649       659 
           MMP2_HUMAN    30 APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC 660
               SCOP domains d1gxda1 A:1-78 Gelatinase A (MMP-2)                                           d1gxda3 A:79-187,A:365-421 Gelatinase A                                                                      d1gxda4 A:188-248 Gelatinase A (MMP-2) type II modules       d1gxda5 A:249-308 Gelatinase A (MMP-2) type II modules      d1gxda6 A:309-364 Gelatinase A (MMP-2) type II modules  d1gxda3 A:79-187,A:365-421 Gelatinase A                  -------d1gxda2 A:429-631 Gelatinase A (MMP-2), C-terminal domain                                                                                                                                                   SCOP domains
               CATH domains ----------------1gxdA01 A:17-193,A:363-420 Collagenase (Catalytic Domain)                                                                                                                        -----1gxdA02 A:199-251  [code=2.10.10.10, no name defined]-----1gxdA03 A:257-303                              -----------1gxdA04 A:315-361                              -1gxdA01 A:17-193,A:363-420 Collagenase (Catalytic Domain) ---------------1gxdA05 A:436-631 Hemopexin                                                                                                                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhhhhh...................hhhhhhhh..........................................eeeeee.......hhhhhhhhhhhhhhhhhh....eeee........eeeee.................eee..........eeee....ee..........hhhhh.......eee..eee.............eee...hhhhhh.eee.....................ee....ee.............eee...hhhhhh.eee.....................eee..eee.............eee...hhhhhh.eee.....eehhhhhhhhhhhhh........................hhhhhhhhhhhh.....-------....................eee....eee....ee.............ee.hhh..........eee......eeeee..eeeeee..ee.....ee..............eeee......eeeee..ee...............ee.............eeee......eeeee..eee...........eeehhhhh... Sec.struct. author
             SAPs(SNPs) (1) -----------------------------------------------------------------------H------------------------------------------------------------------------------------------------------------Y-----------------T-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------K------------------------------------------V--------------------------------------------------M--------------------------------------------------------------------------------------------------------------------------L----------------------I---------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M-------------------------------------------------------------------------------------------------------------------------------------------------I---------------- SAPs(SNPs) (2)
                PROSITE (1) ----------------------------------------------------------------------CYSTEINE------------------------------------------------------------------------------------------------------------------------FN2_2  PDB: A:199-247 UniProt: 228-276           ---------FN2_2  PDB: A:257-305 UniProt: 286-334           ---------FN2_2  PDB: A:315-363 UniProt: 344-392           -------ZINC_PROTE--------------------------------------------------------------HEMOPEXIN_2  PDB: A:443-487 UniProt: 472-516 HEMOPEXIN_2  PDB: A:488-534 UniProt: 517-563   -HEMOPEXIN_2  PDB: A:536-584 UniProt: 565-613     HEMOPEXIN_2  PDB: A:585-631 UniProt: 614-660    PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FN2_1  PDB: A:204-245 UniProt: 233-274    ----------------FN2_1  PDB: A:262-303 UniProt: 291-332    ----------------FN2_1  PDB: A:320-361 UniProt: 349-390    -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------HEMOPEXIN       --------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1  PDB: A:1-22 Exon 1.3  PDB: A:23-98 UniProt: 52-127                                      -------------------------------------------------Exon 1.5  PDB: A:148-191 UniProt: 177-220   ---------------------------------------------------------Exon 1.7  PDB: A:249-307 UniProt: 278-336                  -------------------------------------------------------------------------------------------------------------Exon 1.10  PDB: A:417-462 (gaps)              ---------------------------------------------Exon 1.12  PDB: A:508-561 UniProt: 537-590            ------------------------------------Exon 1.14b  PDB: A:598-631         Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------------------Exon 1.4  PDB: A:98-148 UniProt: 127-177           ------------------------------------------Exon 1.6  PDB: A:191-249 UniProt: 220-278                  ---------------------------------------------------------Exon 1.8  PDB: A:307-365 UniProt: 336-394                  ------------------------------------------------------------------------------------------------Exon 1.11  PDB: A:462-508 UniProt: 491-537     ----------------------------------------------------Exon 1.13  PDB: A:561-598             --------------------------------- Transcript 1 (2)
           Transcript 1 (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9  PDB: A:365-417 UniProt: 394-446            ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (3)
                 1gxd A   1 APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHAFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPD-------TPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC 631
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420|      430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630 
                                                                                                                                                                                                                                                                                                                                                                                                                                                              421     429

Chain B from PDB  Type:PROTEIN  Length:623
 aligned with MMP2_HUMAN | P08253 from UniProtKB/Swiss-Prot  Length:660

    Alignment length:630
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660
           MMP2_HUMAN    31 PSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC 660
               SCOP domains d1gxdb1 B:2-78 Gelatinase A (MMP-2)                                          d1gxdb3 B:79-187,B:365-421 Gelatinase A                                                                      d1gxdb4 B:188-248 Gelatinase A (MMP-2) type II modules       d1gxdb5 B:249-308 Gelatinase A (MMP-2) type II modules      d1gxdb6 B:309-364 Gelatinase A (MMP-2) type II modules  d1gxdb3 B:79-187,B:365-421 Gelatinase A                  -------d1gxdb2 B:429-631 Gelatinase A (MMP-2), C-terminal domain                                                                                                                                                   SCOP domains
               CATH domains ---------------1gxdB01 B:17-193,B:363-420 Collagenase (Catalytic Domain)                                                                                                                        -----1gxdB02 B:199-251  [code=2.10.10.10, no name defined]-----1gxdB03 B:257-303                              -----------1gxdB04 B:315-361                              -1gxdB01 B:17-193,B:363-420 Collagenase (Catalytic Domain) ---------------1gxdB05 B:436-631 Hemopexin                                                                                                                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..............hhhhhhhhhhhh.........hhhhhh...hhhhhhhh......hhhhhhhhhhh.......................eeeeee.......hhhhhhhhhhhhhhhhhh....eeee.......eeeeee.................eee..........eeee....ee......................eee..eee.............eee...hhhhhh.eee.....................ee....ee.............eee...hhhhhh.eee.....................eee..eee.............eee...hhhhhh.eee.....eehhhhhhhhhhhhh........................hhhhhhhhhhhhh....-------....................eeee..eeeeee..eeeee...........hhhhh.........eeee......eeeee..eeeeee..ee.....ee........................eeee....eeee.............hhhhh.........ee.......eeeeee..eeeeee........eeehhhhh... Sec.struct. author
             SAPs(SNPs) (1) ----------------------------------------------------------------------H------------------------------------------------------------------------------------------------------------Y-----------------T-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------K------------------------------------------V--------------------------------------------------M--------------------------------------------------------------------------------------------------------------------------L----------------------I---------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M-------------------------------------------------------------------------------------------------------------------------------------------------I---------------- SAPs(SNPs) (2)
                PROSITE (1) ---------------------------------------------------------------------CYSTEINE------------------------------------------------------------------------------------------------------------------------FN2_2  PDB: B:199-247 UniProt: 228-276           ---------FN2_2  PDB: B:257-305 UniProt: 286-334           ---------FN2_2  PDB: B:315-363 UniProt: 344-392           -------ZINC_PROTE--------------------------------------------------------------HEMOPEXIN_2  PDB: B:443-487 UniProt: 472-516 HEMOPEXIN_2  PDB: B:488-534 UniProt: 517-563   -HEMOPEXIN_2  PDB: B:536-584 UniProt: 565-613     HEMOPEXIN_2  PDB: B:585-631 UniProt: 614-660    PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FN2_1  PDB: B:204-245 UniProt: 233-274    ----------------FN2_1  PDB: B:262-303 UniProt: 291-332    ----------------FN2_1  PDB: B:320-361 UniProt: 349-390    -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------HEMOPEXIN       --------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1  PDB: B:2-22Exon 1.3  PDB: B:23-98 UniProt: 52-127                                      -------------------------------------------------Exon 1.5  PDB: B:148-191 UniProt: 177-220   ---------------------------------------------------------Exon 1.7  PDB: B:249-307 UniProt: 278-336                  -------------------------------------------------------------------------------------------------------------Exon 1.10  PDB: B:417-462 (gaps)              ---------------------------------------------Exon 1.12  PDB: B:508-561 UniProt: 537-590            ------------------------------------Exon 1.14b  PDB: B:598-631         Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------Exon 1.4  PDB: B:98-148 UniProt: 127-177           ------------------------------------------Exon 1.6  PDB: B:191-249 UniProt: 220-278                  ---------------------------------------------------------Exon 1.8  PDB: B:307-365 UniProt: 336-394                  ------------------------------------------------------------------------------------------------Exon 1.11  PDB: B:462-508 UniProt: 491-537     ----------------------------------------------------Exon 1.13  PDB: B:561-598             --------------------------------- Transcript 1 (2)
           Transcript 1 (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9  PDB: B:365-417 UniProt: 394-446            ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (3)
                 1gxd B   2 PSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHAFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPD-------TPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC 631
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631
                                                                                                                                                                                                                                                                                                                                                                                                                                                             421     429

Chain C from PDB  Type:PROTEIN  Length:192
 aligned with TIMP2_HUMAN | P16035 from UniProtKB/Swiss-Prot  Length:220

    Alignment length:192
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216  
          TIMP2_HUMAN    27 CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIE 218
               SCOP domains d1gxdc_ C: TIMP-2                                                                                                                                                                                SCOP domains
               CATH domains 1gxdC01       1gxdC02 C:15-110  [code=2.40.50.120, no name defined]                                           1gxdC01 C:1-14,C:111-182                                                ---------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......hhhhhhhhh.eee...eeee................eeeee....eee.......eeee..hhhhhh...............eee...eee.............hhhhhhh...hhhhh.....ee..............eehhhhhh....hhhhhh...ee.....ee................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) TIMP         ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) NTR  PDB: C:1-126 UniProt: 27-152                                                                                             ------------------------------------------------------------------ PROSITE (2)
           Transcript 2 (1) Exon 2.1          ---------------------------------Exon 2.3  PDB: C:52-88               -----------------------------------------Exon 2.5b  PDB: C:130-192 UniProt: 156-220 [INCOMPLETE]         Transcript 2 (1)
           Transcript 2 (2) -----------------Exon 2.2b  PDB: C:18-51           ------------------------------------Exon 2.4a  PDB: C:88-129 UniProt: 114-155 --------------------------------------------------------------- Transcript 2 (2)
                 1gxd C   1 CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIE 192
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190

Chain D from PDB  Type:PROTEIN  Length:192
 aligned with TIMP2_HUMAN | P16035 from UniProtKB/Swiss-Prot  Length:220

    Alignment length:192
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216  
          TIMP2_HUMAN    27 CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIE 218
               SCOP domains d1gxdd_ D: TIMP-2                                                                                                                                                                                SCOP domains
               CATH domains 1gxdD01       1gxdD02 D:15-110  [code=2.40.50.120, no name defined]                                           1gxdD01 D:1-14,D:111-182                                                ---------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......hhhhhhhhh.eeeee....eeeeeeeee...eeeeeeeee...............eeee..hhhhh....hhhhh..eeeeeee....eee.......ee....hhhhhh.....hhhhh......................hhhhh..............ee.....ee................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) TIMP         ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) NTR  PDB: D:1-126 UniProt: 27-152                                                                                             ------------------------------------------------------------------ PROSITE (2)
           Transcript 2 (1) Exon 2.1          ---------------------------------Exon 2.3  PDB: D:52-88               -----------------------------------------Exon 2.5b  PDB: D:130-192 UniProt: 156-220 [INCOMPLETE]         Transcript 2 (1)
           Transcript 2 (2) -----------------Exon 2.2b  PDB: D:18-51           ------------------------------------Exon 2.4a  PDB: D:88-129 UniProt: 114-155 --------------------------------------------------------------- Transcript 2 (2)
                 1gxd D   1 CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIE 192
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "Pfam Domain" information available for 1GXD)

Asymmetric Unit(hide GO term definitions)

Chain A,B (MMP2_HUMAN | P08253)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004222	metalloendopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.
	GO:0008237	metallopeptidase activity	Catalysis of the hydrolysis of peptide bonds by a mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0001525	angiogenesis	Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
	GO:0001955	blood vessel maturation	A developmental process, independent of morphogenetic (shape) change, that is required for a blood vessel to attain its fully functional state.
	GO:0060346	bone trabecula formation	The process of creating a trabecula in the bone. A trabecula is a tissue element in the form of a small beam, strut or rod.
	GO:0044267	cellular protein metabolic process	The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
	GO:0071230	cellular response to amino acid stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amino acid stimulus. An amino acid is a carboxylic acids containing one or more amino groups.
	GO:0030574	collagen catabolic process	The proteolytic chemical reactions and pathways resulting in the breakdown of collagen in the extracellular matrix, usually carried out by proteases secreted by nearby cells.
	GO:0007566	embryo implantation	Attachment of the blastocyst to the uterine lining.
	GO:0035987	endodermal cell differentiation	The process in which a relatively unspecialized cell acquires the specialized features of an endoderm cell, a cell of the inner of the three germ layers of the embryo.
	GO:0048013	ephrin receptor signaling pathway	The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin.
	GO:0022617	extracellular matrix disassembly	A process that results in the breakdown of the extracellular matrix.
	GO:0060325	face morphogenesis	The process in which the anatomical structures of the face are generated and organized. The face is the ventral division of the head.
	GO:0001957	intramembranous ossification	Direct ossification that occurs within mesenchyme or an accumulation of relatively unspecialized cells.
	GO:0045089	positive regulation of innate immune response	Any process that activates or increases the frequency, rate or extent of the innate immune response, the organism's first line of defense against infection.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0001666	response to hypoxia	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
	GO:0048705	skeletal system morphogenesis	The process in which the anatomical structures of the skeleton are generated and organized.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0031012	extracellular matrix	A structure lying external to one or more cells, which provides structural support for cells or tissues.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0005578	proteinaceous extracellular matrix	A layer consisting mainly of proteins (especially collagen) and glycosaminoglycans (mostly as proteoglycans) that forms a sheet underlying or overlying cells such as endothelial and epithelial cells. The proteins are secreted by cells in the vicinity. An example of this component is found in Mus musculus.
	GO:0030017	sarcomere	The repeating unit of a myofibril in a muscle cell, composed of an array of overlapping thick and thin filaments between two adjacent Z discs.

Chain C,D (TIMP2_HUMAN | P16035)

molecular function
	GO:0004857	enzyme inhibitor activity	Binds to and stops, prevents or reduces the activity of an enzyme.
	GO:0005178	integrin binding	Interacting selectively and non-covalently with an integrin.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0008191	metalloendopeptidase inhibitor activity	Stops, prevents or reduces the activity of metalloendopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain and contain a chelated metal ion at their active sites which is essential to their catalytic activity.
	GO:0030414	peptidase inhibitor activity	Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
	GO:0002020	protease binding	Interacting selectively and non-covalently with any protease or peptidase.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0007568	aging	A developmental process that is a deterioration and loss of function over time. Aging includes loss of functions such as resistance to disease, homeostasis, and fertility, as well as wear and tear. Aging includes cellular senescence, but is more inclusive. May precede death and may succeed developmental maturation (GO:0021700).
	GO:0007417	central nervous system development	The process whose specific outcome is the progression of the central nervous system over time, from its formation to the mature structure. The central nervous system is the core nervous system that serves an integrating and coordinating function. In vertebrates it consists of the brain and spinal cord. In those invertebrates with a central nervous system it typically consists of a brain, cerebral ganglia and a nerve cord.
	GO:0022617	extracellular matrix disassembly	A process that results in the breakdown of the extracellular matrix.
	GO:0046580	negative regulation of Ras protein signal transduction	Any process that stops, prevents, or reduces the frequency, rate or extent of Ras protein signal transduction.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0010951	negative regulation of endopeptidase activity	Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
	GO:0051045	negative regulation of membrane protein ectodomain proteolysis	Any process that stops, prevents, or reduces the frequency, rate or extent of membrane protein ectodomain proteolysis.
	GO:0045930	negative regulation of mitotic cell cycle	Any process that stops, prevents or reduces the rate or extent of progression through the mitotic cell cycle.
	GO:0010466	negative regulation of peptidase activity	Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.
	GO:0045861	negative regulation of proteolysis	Any process that stops, prevents, or reduces the frequency, rate or extent of the hydrolysis of a peptide bond or bonds within a protein.
	GO:0043410	positive regulation of MAPK cascade	Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the MAPK cascade.
	GO:0045762	positive regulation of adenylate cyclase activity	Any process that activates or increases the frequency, rate or extent of adenylate cyclase activity.
	GO:0045666	positive regulation of neuron differentiation	Any process that activates or increases the frequency, rate or extent of neuron differentiation.
	GO:0032487	regulation of Rap protein signal transduction	Any process that modulates the frequency, rate or extent of Rap protein signal transduction.
	GO:0034097	response to cytokine	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0009725	response to hormone	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hormone stimulus.
cellular component
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0030426	growth cone	The migrating motile tip of a growing nerve cell axon or dendrite.
	GO:0043005	neuron projection	A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
	GO:0043025	neuronal cell body	The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
	GO:0005578	proteinaceous extracellular matrix	A layer consisting mainly of proteins (especially collagen) and glycosaminoglycans (mostly as proteoglycans) that forms a sheet underlying or overlying cells such as endothelial and epithelial cells. The proteins are secreted by cells in the vicinity. An example of this component is found in Mus musculus.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gly A:476 - Pro A:477	[ RasMol ]
		Gly B:476 - Pro B:477	[ RasMol ]
		Ile C:136 - Pro C:137	[ RasMol ]
		Ile D:136 - Pro D:137	[ RasMol ]
		Phe A:206 - Pro A:207	[ RasMol ]
		Phe A:264 - Pro A:265	[ RasMol ]
		Phe A:322 - Pro A:323	[ RasMol ]
		Phe A:573 - Pro A:574	[ RasMol ]
		Phe B:206 - Pro B:207	[ RasMol ]
		Phe B:264 - Pro B:265	[ RasMol ]
		Phe B:322 - Pro B:323	[ RasMol ]
		Phe B:573 - Pro B:574	[ RasMol ]
		Tyr A:523 - Pro A:524	[ RasMol ]
		Tyr B:523 - Pro B:524	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1gxd
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MMP2_HUMAN \| P08253
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	TIMP2_HUMAN \| P16035
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.24.24
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	259600
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	MMP2_HUMAN \| P08253
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	TIMP2_HUMAN \| P16035
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	MMP2_HUMAN \| P08253	:	1ck7 1cxw 1eak 1gen 1hov 1j7m 1ks0 1qib 1rtg 3ayu
	TIMP2_HUMAN \| P16035	:	1br9 2tmp 4ilw

1br9	HUMAN TISSUE INHIBITOR OF METALLOPROTEINASE-2
1ck7	GELATINASE A (FULL-LENGTH)
1cxw	THE SECOND TYPE II MODULE FROM HUMAN MATRIXMETALLOPROTEINASE 2
1eak	CATALYTIC DOMAIN OF PROMMP-2 E404Q MUTANT
1gen	C-TERMINAL DOMAIN OF GELATINASE A
1j7m	THE THIRD FIBRONECTIN TYPE II MODULE FROM HUMAN MATRIXMETALLOPROTEINASE 2
1ks0	THE FIRST FIBRONECTIN TYPE II MODULE FROM HUMAN MATRIXMETALLOPROTEINASE 2
1rtg	C-TERMINAL DOMAIN (HAEMOPEXIN-LIKE DOMAIN) OF HUMAN MATRIXMETALLOPROTEINASE-2
2tmp	N-TERMINAL DOMAIN OF TISSUE INHIBITOR OF METALLOPROTEINASE-2 (N-TIMP-2), NMR, 49 STRUCTURES

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 8)

Sites (8, 8)

SS Bonds (29, 29)

Cis Peptide Bonds (14, 14)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (11, 22)

PROSITE Motifs (8, 30)

Exons (18, 36)

Sequences/Alignments

Classification and Annotation

SCOP Domains (5, 14)

CATH Domains (5, 14)

Pfam Domains (0, 0)

Gene Ontology (60, 66)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File