|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 36)
|
Asymmetric Unit (36, 36)
|
(no "SS Bond" information available for 1GQM) |
(no "Cis Peptide Bond" information available for 1GQM) |
(no "SAP(SNP)/Variant" information available for 1GQM) |
Asymmetric Unit (2, 24)
|
Asymmetric Unit (2, 24)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:87 aligned with S10AC_HUMAN | P80511 from UniProtKB/Swiss-Prot Length:92 Alignment length:87 11 21 31 41 51 61 71 81 S10AC_HUMAN 2 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH 88 SCOP domains d1gqma_ A: Calcyclin (S100) SCOP domains CATH domains 1gqmA00 A:1-87 EF-hand CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------------------------------------------EF_HAND_2 PDB: A:48-83 ---- PROSITE (1) PROSITE (2) -------------------------------------------------------S100_CABP PDB: A:56-7---------- PROSITE (2) Transcript 1 Exon 1.2 PDB: A:1-45 UniProt: 1-46 Exon 1.4a PDB: A:46-87 UniProt: 47-92 Transcript 1 1gqm A 1 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH 87 10 20 30 40 50 60 70 80 Chain B from PDB Type:PROTEIN Length:88 aligned with S10AC_HUMAN | P80511 from UniProtKB/Swiss-Prot Length:92 Alignment length:88 11 21 31 41 51 61 71 81 S10AC_HUMAN 2 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHT 89 SCOP domains d1gqmb_ B: Calcyclin (S100) SCOP domains CATH domains 1gqmB00 B:1-88 EF-hand CATH domains Pfam domains ---------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------------------------------------------EF_HAND_2 PDB: B:48-83 ----- PROSITE (1) PROSITE (2) -------------------------------------------------------S100_CABP PDB: B:56-7----------- PROSITE (2) Transcript 1 Exon 1.2 PDB: B:1-45 UniProt: 1-46 Exon 1.4a PDB: B:46-88 UniProt: 47-92 Transcript 1 1gqm B 1 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHT 88 10 20 30 40 50 60 70 80 Chain C from PDB Type:PROTEIN Length:87 aligned with S10AC_HUMAN | P80511 from UniProtKB/Swiss-Prot Length:92 Alignment length:87 11 21 31 41 51 61 71 81 S10AC_HUMAN 2 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH 88 SCOP domains d1gqmc_ C: Calcyclin (S100) SCOP domains CATH domains 1gqmC00 C:1-87 EF-hand CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------------------------------------------EF_HAND_2 PDB: C:48-83 ---- PROSITE (1) PROSITE (2) -------------------------------------------------------S100_CABP PDB: C:56-7---------- PROSITE (2) Transcript 1 Exon 1.2 PDB: C:1-45 UniProt: 1-46 Exon 1.4a PDB: C:46-87 UniProt: 47-92 Transcript 1 1gqm C 1 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH 87 10 20 30 40 50 60 70 80 Chain D from PDB Type:PROTEIN Length:87 aligned with S10AC_HUMAN | P80511 from UniProtKB/Swiss-Prot Length:92 Alignment length:87 11 21 31 41 51 61 71 81 S10AC_HUMAN 2 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH 88 SCOP domains d1gqmd_ D: Calcyclin (S100) SCOP domains CATH domains 1gqmD00 D:1-87 EF-hand CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------------------------------------------EF_HAND_2 PDB: D:48-83 ---- PROSITE (1) PROSITE (2) -------------------------------------------------------S100_CABP PDB: D:56-7---------- PROSITE (2) Transcript 1 Exon 1.2 PDB: D:1-45 UniProt: 1-46 Exon 1.4a PDB: D:46-87 UniProt: 47-92 Transcript 1 1gqm D 1 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH 87 10 20 30 40 50 60 70 80 Chain E from PDB Type:PROTEIN Length:87 aligned with S10AC_HUMAN | P80511 from UniProtKB/Swiss-Prot Length:92 Alignment length:87 11 21 31 41 51 61 71 81 S10AC_HUMAN 2 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH 88 SCOP domains d1gqme_ E: Calcyclin (S100) SCOP domains CATH domains 1gqmE00 E:1-87 EF-hand CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------------------------------------------EF_HAND_2 PDB: E:48-83 ---- PROSITE (1) PROSITE (2) -------------------------------------------------------S100_CABP PDB: E:56-7---------- PROSITE (2) Transcript 1 Exon 1.2 PDB: E:1-45 UniProt: 1-46 Exon 1.4a PDB: E:46-87 UniProt: 47-92 Transcript 1 1gqm E 1 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH 87 10 20 30 40 50 60 70 80 Chain F from PDB Type:PROTEIN Length:87 aligned with S10AC_HUMAN | P80511 from UniProtKB/Swiss-Prot Length:92 Alignment length:87 11 21 31 41 51 61 71 81 S10AC_HUMAN 2 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH 88 SCOP domains d1gqmf_ F: Calcyclin (S100) SCOP domains CATH domains 1gqmF00 F:1-87 EF-hand CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------------------------------------------EF_HAND_2 PDB: F:48-83 ---- PROSITE (1) PROSITE (2) -------------------------------------------------------S100_CABP PDB: F:56-7---------- PROSITE (2) Transcript 1 Exon 1.2 PDB: F:1-45 UniProt: 1-46 Exon 1.4a PDB: F:46-87 UniProt: 47-92 Transcript 1 1gqm F 1 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH 87 10 20 30 40 50 60 70 80 Chain G from PDB Type:PROTEIN Length:87 aligned with S10AC_HUMAN | P80511 from UniProtKB/Swiss-Prot Length:92 Alignment length:87 11 21 31 41 51 61 71 81 S10AC_HUMAN 2 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH 88 SCOP domains d1gqmg_ G: Calcyclin (S100) SCOP domains CATH domains 1gqmG00 G:1-87 EF-hand CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------------------------------------------EF_HAND_2 PDB: G:48-83 ---- PROSITE (1) PROSITE (2) -------------------------------------------------------S100_CABP PDB: G:56-7---------- PROSITE (2) Transcript 1 Exon 1.2 PDB: G:1-45 UniProt: 1-46 Exon 1.4a PDB: G:46-87 UniProt: 47-92 Transcript 1 1gqm G 1 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH 87 10 20 30 40 50 60 70 80 Chain H from PDB Type:PROTEIN Length:88 aligned with S10AC_HUMAN | P80511 from UniProtKB/Swiss-Prot Length:92 Alignment length:88 11 21 31 41 51 61 71 81 S10AC_HUMAN 2 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHT 89 SCOP domains d1gqmh_ H: Calcyclin (S100) SCOP domains CATH domains 1gqmH00 H:1-88 EF-hand CATH domains Pfam domains ---------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------------------------------------------EF_HAND_2 PDB: H:48-83 ----- PROSITE (1) PROSITE (2) -------------------------------------------------------S100_CABP PDB: H:56-7----------- PROSITE (2) Transcript 1 Exon 1.2 PDB: H:1-45 UniProt: 1-46 Exon 1.4a PDB: H:46-88 UniProt: 47-92 Transcript 1 1gqm H 1 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHT 88 10 20 30 40 50 60 70 80 Chain I from PDB Type:PROTEIN Length:87 aligned with S10AC_HUMAN | P80511 from UniProtKB/Swiss-Prot Length:92 Alignment length:87 11 21 31 41 51 61 71 81 S10AC_HUMAN 2 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH 88 SCOP domains d1gqmi_ I: Calcyclin (S100) SCOP domains CATH domains 1gqmI00 I:1-87 EF-hand CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------------------------------------------EF_HAND_2 PDB: I:48-83 ---- PROSITE (1) PROSITE (2) -------------------------------------------------------S100_CABP PDB: I:56-7---------- PROSITE (2) Transcript 1 Exon 1.2 PDB: I:1-45 UniProt: 1-46 Exon 1.4a PDB: I:46-87 UniProt: 47-92 Transcript 1 1gqm I 1 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH 87 10 20 30 40 50 60 70 80 Chain J from PDB Type:PROTEIN Length:87 aligned with S10AC_HUMAN | P80511 from UniProtKB/Swiss-Prot Length:92 Alignment length:87 11 21 31 41 51 61 71 81 S10AC_HUMAN 2 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH 88 SCOP domains d1gqmj_ J: Calcyclin (S100) SCOP domains CATH domains 1gqmJ00 J:1-87 EF-hand CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------------------------------------------EF_HAND_2 PDB: J:48-83 ---- PROSITE (1) PROSITE (2) -------------------------------------------------------S100_CABP PDB: J:56-7---------- PROSITE (2) Transcript 1 Exon 1.2 PDB: J:1-45 UniProt: 1-46 Exon 1.4a PDB: J:46-87 UniProt: 47-92 Transcript 1 1gqm J 1 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH 87 10 20 30 40 50 60 70 80 Chain K from PDB Type:PROTEIN Length:87 aligned with S10AC_HUMAN | P80511 from UniProtKB/Swiss-Prot Length:92 Alignment length:87 11 21 31 41 51 61 71 81 S10AC_HUMAN 2 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH 88 SCOP domains d1gqmk_ K: Calcyclin (S100) SCOP domains CATH domains 1gqmK00 K:1-87 EF-hand CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------------------------------------------EF_HAND_2 PDB: K:48-83 ---- PROSITE (1) PROSITE (2) -------------------------------------------------------S100_CABP PDB: K:56-7---------- PROSITE (2) Transcript 1 Exon 1.2 PDB: K:1-45 UniProt: 1-46 Exon 1.4a PDB: K:46-87 UniProt: 47-92 Transcript 1 1gqm K 1 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH 87 10 20 30 40 50 60 70 80 Chain L from PDB Type:PROTEIN Length:86 aligned with S10AC_HUMAN | P80511 from UniProtKB/Swiss-Prot Length:92 Alignment length:86 11 21 31 41 51 61 71 81 S10AC_HUMAN 2 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHY 87 SCOP domains d1gqml_ L: Calcyclin (S100) SCOP domains CATH domains 1gqmL00 L:1-86 EF-hand CATH domains Pfam domains -------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------------------------------------------EF_HAND_2 PDB: L:48-83 --- PROSITE (1) PROSITE (2) -------------------------------------------------------S100_CABP PDB: L:56-7--------- PROSITE (2) Transcript 1 Exon 1.2 PDB: L:1-45 UniProt: 1-46 Exon 1.4a PDB: L:46-86 UniProt: 47-92 Transcript 1 1gqm L 1 TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHY 86 10 20 30 40 50 60 70 80
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 1GQM) |
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D,E,F,G,H,I,J,K,L (S10AC_HUMAN | P80511)
|
|
|
|
|
|
|