|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1G6P) |
Sites (0, 0)| (no "Site" information available for 1G6P) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1G6P) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1G6P) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1G6P) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1G6P) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:66 aligned with CSP_THEMA | O54310 from UniProtKB/Swiss-Prot Length:66 Alignment length:66 10 20 30 40 50 60 CSP_THEMA 1 MRGKVKWFDSKKGYGFITKDEGGDVFVHWSAIEMEGFKTLKEGQVVEFEIQEGKKGPQAAHVKVVE 66 SCOP domains d1g6pa_ A: Major cold shock protein SCOP domains CATH domains 1g6pA00 A:1-66 Nucleic acid-binding proteins CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE -------------COLD_SHOCK ---------------------------------- PROSITE Transcript ------------------------------------------------------------------ Transcript 1g6p A 1 MRGKVKWFDSKKGYGFITKDEGGDVFVHWSAIEMEGFKTLKEGQVVEFEIQEGKKGPQAAHVKVVE 66 10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1G6P) |
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (CSP_THEMA | O54310)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|