1G1J - JenaLib

Title :   CRYSTAL STRUCTURE OF THE OLIGOMERIZATION DOMAIN FROM ROTAVIRUS NSP4

Authors :   G. D. Bowman, I. M. Nodelman, C. E. Schutt

Date :   11 Oct 00 (Deposition) - 10 Jan 01 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.86

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (2x)

Keywords :   Ns28, Parallel Coiled-Coil, Homo-Tetramer, Metal Binding Site, Strontium, Cation, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   G. D. Bowman, I. M. Nodelman, O. Levy, S. L. Lin, P. Tian, T. J. Zamb, S. A. Udem, B. Venkataraghavan, C. E. Schutt
Crystal Structure Of The Oligomerization Domain Of Nsp4 Fro Rotavirus Reveals A Core Metal-Binding Site.
J. Mol. Biol. V. 304 861 2000
PubMed-ID: 11124032 | Reference-DOI: 10.1006/JMBI.2000.4250

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 3)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:43
 aligned with NSP4_ROTS1 | P04512 from UniProtKB/Swiss-Prot  Length:175

    Alignment length:43
                                   104       114       124       134   
           NSP4_ROTS1    95 IEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQ 137
               SCOP domains d1g1ja_ A: NSP4 oligomerization domain      SCOP domains
               CATH domains 1g1jA00 A:95-137                            CATH domains
               Pfam domains ------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------- PROSITE
                 Transcript ------------------------------------------- Transcript
                 1g1j A  95 IEKQMDRVVKEMRRQLEmIDKLTTREIEQVELLKRIYDKLTVQ 137
                                   104       114       124       134   
                                           112-MSE

Chain A from PDB  Type:PROTEIN  Length:43
 aligned with O92323_9REOV | O92323 from UniProtKB/TrEMBL  Length:175

    Alignment length:43
                                   104       114       124       134   
         O92323_9REOV    95 IEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQ 137
               SCOP domains d1g1ja_ A: NSP4 oligomerization domain      SCOP domains
               CATH domains 1g1jA00 A:95-137                            CATH domains
               Pfam domains ------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------- PROSITE
                 Transcript ------------------------------------------- Transcript
                 1g1j A  95 IEKQMDRVVKEMRRQLEmIDKLTTREIEQVELLKRIYDKLTVQ 137
                                   104       114       124       134   
                                           112-MSE

Chain B from PDB  Type:PROTEIN  Length:43
 aligned with NSP4_ROTS1 | P04512 from UniProtKB/Swiss-Prot  Length:175

    Alignment length:43
                                   104       114       124       134   
           NSP4_ROTS1    95 IEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQ 137
               SCOP domains d1g1jb_ B: NSP4 oligomerization domain      SCOP domains
               CATH domains 1g1jB00 B:95-137                            CATH domains
               Pfam domains ------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------- PROSITE
                 Transcript ------------------------------------------- Transcript
                 1g1j B  95 IEKQMDRVVKEMRRQLEmIDKLTTREIEQVELLKRIYDKLTVQ 137
                                   104       114       124       134   
                                           112-MSE

Chain B from PDB  Type:PROTEIN  Length:43
 aligned with O92323_9REOV | O92323 from UniProtKB/TrEMBL  Length:175

    Alignment length:43
                                   104       114       124       134   
         O92323_9REOV    95 IEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQ 137
               SCOP domains d1g1jb_ B: NSP4 oligomerization domain      SCOP domains
               CATH domains 1g1jB00 B:95-137                            CATH domains
               Pfam domains ------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------- PROSITE
                 Transcript ------------------------------------------- Transcript
                 1g1j B  95 IEKQMDRVVKEMRRQLEmIDKLTTREIEQVELLKRIYDKLTVQ 137
                                   104       114       124       134   
                                           112-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (10, 12)

Asymmetric Unit(hide GO term definitions)

Chain A,B (NSP4_ROTS1 | P04512)

molecular function
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0044155	host caveola	A small pit, depression, or invagination, such as any of the minute pits or incuppings of the host cell membrane formed during pinocytosis, that communicates with the outside of a host cell and extends inward, indenting the host cytoplasm and the host cell membrane. Such caveolae may be pinched off to form free vesicles within the host cytoplasm. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0044165	host cell endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the host cell cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The host ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0033644	host cell membrane	Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0044169	host cell rough endoplasmic reticulum membrane	The lipid bilayer surrounding the host cell rough endoplasmic reticulum.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Chain A,B (O92323_9REOV | O92323)

cellular component
	GO:0016021		integral component of membrane		The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020		membrane		A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SR	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1g1j)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1g1j
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	NSP4_ROTS1 \| P04512
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	O92323_9REOV \| O92323
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description