1FYH - JenaLib

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:242
 aligned with IFNG_HUMAN | P01579 from UniProtKB/Swiss-Prot  Length:166

    Alignment length:242
                                                                                                                                                                                    151                                                                                       
                                                                                                                                                      147                        148  |  152 156      157      166                                                            
                                    32        42        52        62        72        82        92       102       112       122       132       142    |    -         -         - |  |  152   |     -  |    164 |       -         -         -         -         -         -  
           IFNG_HUMAN    23 CQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAA--------------------------KTGK----RKRSQ--------MLFRGRRASQ------------------------------------------------------------   -
               SCOP domains d1fyha1 A:0-124 Interferon-gamma                                                                                             d1fyha2 A:201-324 Interferon-gamma                                                                                    SCOP domains
               CATH domains 1fyhA01 A:0-121  [code=1.20.1250.10, no name defined]                                                                     ---1fyhA02 A:201-324  [code=1.20.1250.10, no name defined]                                                               CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh..hhhhhh....hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhh.....hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------Q------------------------------------------------------------------------------------------------------------------------------------------------------------------------Q------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1        Exon 1.2  PDB: A:16-38 Exon 1.3  PDB: A:39-99 UniProt: 62-122                       Exon 1.4  PDB: A:100-264 (gaps) UniProt: 123-166                                  ------------------------------------------------------------ Transcript 1
                 1fyh A   0 MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIDELIQVMAELGANVSGEFVKEAENLKKYFNDNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAA 324
                                     9        19        29        39        49        59        69        79        89        99       109       119    || 205       215||     232       242       252       262       272       282       292       302       312       322  
                                                                                                                                                      124|            216|                                                                                                    
                                                                                                                                                       201             224

Chain B from PDB  Type:PROTEIN  Length:201
 aligned with INGR1_HUMAN | P15260 from UniProtKB/Swiss-Prot  Length:489

    Alignment length:212
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238  
          INGR1_HUMAN    29 VPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFN 240
               SCOP domains d1fyhb1 B:12-109 Interferon-gamma receptor alpha chain                                            d1fyhb2 B:110-223 Interfer           on-gamma receptor alpha chain                                                 SCOP domains
               CATH domains 1fyhB01 B:12-108 Immunoglobulins                                                                 1fyhB02 B:109-222 Immunoglo           bulins                                                                      - CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee......eeeee........eeeeeeee........eeeeeee...eee.hhhh......eeeeeeeee..ee...ee....hhhhhh.....eeeeee...eeeeeee.hhhhh-----------.....eeeeeeeeee..eeeeeeee..........eeeeeee......eeeeeeeeee............eeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------I---------------Y---------T--------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) 2-------------------------------------Exon 2.4a  PDB: B:50-108 UniProt: 67-125                   ---------------------------------------------------------Exon 2.6b  PDB: B:166-223 UniProt: 183-245 [INCOMPLETE]    Transcript 2 (1)
           Transcript 2 (2) Exon 2.3a  PDB: B:12-50 UniProt: 29-67 ---------------------------------------------------------Exon 2.5b  PDB: B:108-165 (gaps) UniProt: 125-182         ---------------------------------------------------------- Transcript 2 (2)
                 1fyh B  12 VPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFV-----------ETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFN 223
                                    21        31        41        51        61        71        81        91       101       111       121       131   |     -     | 151       161       171       181       191       201       211       221  
                                                                                                                                                     135         147

Chain D from PDB  Type:PROTEIN  Length:240
 aligned with IFNG_HUMAN | P01579 from UniProtKB/Swiss-Prot  Length:166

    Alignment length:240
                                                                                                                                                                                  151                                                                                       
                                                                                                                                                      147                      148  |  152 156      157      166                                                            
                                    32        42        52        62        72        82        92       102       112       122       132       142    |    -         -       148  |    154 |       -|      166         -         -         -         -         -         -
           IFNG_HUMAN    23 CQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAA------------------------KTGK----RKRSQ--------MLFRGRRASQ------------------------------------------------------------   -
               SCOP domains d1fyhd1 D:0-124 Interferon-gamma                                                                                             d1fyhd2 D:201-324 Interferon-gamma                                                                                  SCOP domains
               CATH domains 1fyhD01 D:0-121  [code=1.20.1250.10, no name defined]                                                                     ---1fyhD02 D:201-324  [code=1.20.1250.10, no name defined]                                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhh...hhhhhh....hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhh...hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------Q----------------------------------------------------------------------------------------------------------------------------------------------------------------------Q------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
               Transcript 1 Exon 1.1        Exon 1.2  PDB: D:16-38 Exon 1.3  PDB: D:39-99 UniProt: 62-122                       Exon 1.4  PDB: D:100-264 (gaps) UniProt: 123-166                                ------------------------------------------------------------ Transcript 1
                 1fyh D   0 MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIDELIQVMAELGANVSGEFVKEAENLKKYFNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAA 324
                                     9        19        29        39        49        59        69        79        89        99       109       119    || 205       215||     234       244       254       264       274       284       294       304       314       324
                                                                                                                                                      124|            216|                                                                                                  
                                                                                                                                                       201             226

Chain E from PDB  Type:PROTEIN  Length:201
 aligned with INGR1_HUMAN | P15260 from UniProtKB/Swiss-Prot  Length:489

    Alignment length:211
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238 
          INGR1_HUMAN    29 VPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIF 239
               SCOP domains d1fyhe1 E:12-109 Interferon-gamma receptor alpha chain                                            d1fyhe2 E:110-222 Interfer          on-gamma receptor alpha chain                                                 SCOP domains
               CATH domains 1fyhE01 E:12-108 Immunoglobulins                                                                 1fyhE02 E:109-221 Immunoglo          bulins                                                                      - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee......eeeee........eeeeeeee........eeeeeee...eee.hhhh......eeeeeeeee..ee...ee....hhhhhh.....eeeeee...eeeeeee.hhhhh----------......eeeeeeeeee..eeeeeeee..........eeeeeee......eeeeeeeeee............eeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------I---------------Y---------T-------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) 2-------------------------------------Exon 2.4a  PDB: E:50-108 UniProt: 67-125                   ---------------------------------------------------------Exon 2.6b  PDB: E:166-222 UniProt: 183-245 [INCOMPLETE]   Transcript 2 (1)
           Transcript 2 (2) Exon 2.3a  PDB: E:12-50 UniProt: 29-67 ---------------------------------------------------------Exon 2.5b  PDB: E:108-165 (gaps) UniProt: 125-182         --------------------------------------------------------- Transcript 2 (2)
                 1fyh E  12 VPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFV----------PETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIF 222
                                    21        31        41        51        61        71        81        91       101       111       121       131   |     -    |  151       161       171       181       191       201       211       221 
                                                                                                                                                     135        146

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain A,D (IFNG_HUMAN | P01579)

molecular function
	GO:0005125	cytokine activity	Functions to control the survival, growth, differentiation and effector function of tissues and cells.
	GO:0005133	interferon-gamma receptor binding	Interacting selectively and non-covalently with the interferon-gamma receptor.
biological process
	GO:0002302	CD8-positive, alpha-beta T cell differentiation involved in immune response	The process in which an antigenically naive CD8-positive, alpha-beta T cell acquires the specialized features of an effector, regulatory, or memory T cell as part of an immune response. Effector T cells include cells which provide T cell help or exhibit cytotoxicity towards other cells.
	GO:0050852	T cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
	GO:0002250	adaptive immune response	An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory).
	GO:0019882	antigen processing and presentation	The process in which an antigen-presenting cell expresses antigen (peptide or lipid) on its cell surface in association with an MHC protein complex.
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0007050	cell cycle arrest	A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
	GO:0007166	cell surface receptor signaling pathway	A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0071351	cellular response to interleukin-18	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-18 stimulus.
	GO:0071222	cellular response to lipopolysaccharide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0042742	defense response to bacterium	Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
	GO:0042832	defense response to protozoan	Reactions triggered in response to the presence of a protozoan that act to protect the cell or organism.
	GO:0051607	defense response to virus	Reactions triggered in response to the presence of a virus that act to protect the cell or organism.
	GO:0030968	endoplasmic reticulum unfolded protein response	The series of molecular signals generated as a consequence of the presence of unfolded proteins in the endoplasmic reticulum (ER) or other ER-related stress; results in changes in the regulation of transcription and translation.
	GO:0097191	extrinsic apoptotic signaling pathway	A series of molecular signals in which a signal is conveyed from the cell surface to trigger the apoptotic death of a cell. The pathway starts with either a ligand binding to a cell surface receptor, or a ligand being withdrawn from a cell surface receptor (e.g. in the case of signaling by dependence receptors), and ends when the execution phase of apoptosis is triggered.
	GO:0006959	humoral immune response	An immune response mediated through a body fluid.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0006925	inflammatory cell apoptotic process	Any apoptotic process in an inflammatory cell, any cell participating in the inflammatory response to a foreign substance e.g. neutrophil, macrophage.
	GO:0060333	interferon-gamma-mediated signaling pathway	A series of molecular signals initiated by the binding of interferon-gamma to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription. Interferon gamma is the only member of the type II interferon found so far.
	GO:0006928	movement of cell or subcellular component	The directed, self-propelled movement of a cell or subcellular component without the involvement of an external agent such as a transporter or a pore.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0030857	negative regulation of epithelial cell differentiation	Any process that stops, prevents, or reduces the frequency, rate or extent of epithelial cell differentiation.
	GO:0010629	negative regulation of gene expression	Any process that decreases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0044130	negative regulation of growth of symbiont in host	Any process in which the symbiont stops, prevents or reduces its increase in size or mass within the cells or tissues of the host organism. The host is defined as the larger of the organisms involved in the symbiotic interaction.
	GO:0044146	negative regulation of growth of symbiont involved in interaction with host	Any process that stops, prevents, or reduces the frequency, rate or extent of the increase in size or mass of an organism occurring in, on or near the exterior of its host organism.
	GO:0032700	negative regulation of interleukin-17 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of production of any member of the interleukin-17 family of cytokines.
	GO:0031642	negative regulation of myelination	Any process that stops, prevents, or reduces the frequency, rate or extent of the formation of a myelin sheath around nerve axons.
	GO:0048662	negative regulation of smooth muscle cell proliferation	Any process that stops, prevents or reduces the rate or extent of smooth muscle cell proliferation.
	GO:0000122	negative regulation of transcription from RNA polymerase II promoter	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0001781	neutrophil apoptotic process	Any apoptotic process in a neutrophil, any of the immature or mature forms of a granular leukocyte that in its mature form has a nucleus with three to five lobes connected by slender threads of chromatin, and cytoplasm containing fine inconspicuous granules and stainable by neutral dyes.
	GO:0030593	neutrophil chemotaxis	The directed movement of a neutrophil cell, the most numerous polymorphonuclear leukocyte found in the blood, in response to an external stimulus, usually an infection or wounding.
	GO:0032834	positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation involved in immune response	Any process that activates or increases the frequency, rate or extent of differentiation of CD4-positive, CD25-positive, alpha-beta regulatory T cells as part of an immune response.
	GO:0045348	positive regulation of MHC class II biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of MHC class II.
	GO:0042102	positive regulation of T cell proliferation	Any process that activates or increases the rate or extent of T cell proliferation.
	GO:0010508	positive regulation of autophagy	Any process that activates, maintains or increases the rate of autophagy. Autophagy is the process in which cells digest parts of their own cytoplasm.
	GO:0060559	positive regulation of calcidiol 1-monooxygenase activity	Any process that increases the rate, frequency or extent of calcidiol 1-monooxygenase activity. Calcidiol 1-monooxygenase activity is the catalysis of the reaction: calcidiol + NADPH + H+ + O2 = calcitriol + NADP+ + H2O.
	GO:0045785	positive regulation of cell adhesion	Any process that activates or increases the frequency, rate or extent of cell adhesion.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0045080	positive regulation of chemokine biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of chemokines.
	GO:0010634	positive regulation of epithelial cell migration	Any process that activates or increases the frequency, rate or extent of epithelial cell migration.
	GO:0090004	positive regulation of establishment of protein localization to plasma membrane	Any process that increases the frequency, rate or extent of the directed movement of a protein to a specific location in the plasma membrane.
	GO:1903543	positive regulation of exosomal secretion	Any process that activates or increases the frequency, rate or extent of exosomal secretion.
	GO:0060550	positive regulation of fructose 1,6-bisphosphate 1-phosphatase activity	Any process that increases the rate, frequency or extent of fructose 1,6-bisphosphate 1-phosphatase activity. Fructose 1,6-bisphosphate 1-phosphatase activity is the catalysis of the reaction: D-fructose 1,6-bisphosphate + H2O = D-fructose 6-phosphate + phosphate.
	GO:0060552	positive regulation of fructose 1,6-bisphosphate metabolic process	Any process that increases the rate, frequency or extent of fructose 1,6-bisphosphate metabolism. Fructose 1,6-bisphosphate metabolism is the chemical reactions and pathways involving fructose 1,6-bisphosphate, also known as FBP. The D enantiomer is a metabolic intermediate in glycolysis and gluconeogenesis.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0050718	positive regulation of interleukin-1 beta secretion	Any process that activates or increases the frequency, rate or extent of the regulated release of interleukin-1 beta from a cell.
	GO:0045084	positive regulation of interleukin-12 biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of interleukin-12.
	GO:0032735	positive regulation of interleukin-12 production	Any process that activates or increases the frequency, rate, or extent of interleukin-12 production.
	GO:0032747	positive regulation of interleukin-23 production	Any process that activates or increases the frequency, rate, or extent of interleukin-23 production.
	GO:0045410	positive regulation of interleukin-6 biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of interleukin-6.
	GO:0048304	positive regulation of isotype switching to IgG isotypes	Any process that activates or increases the frequency, rate or extent of isotype switching to IgG isotypes.
	GO:0051712	positive regulation of killing of cells of other organism	Any process that activates or increases the frequency, rate or extent of the killing by an organism of cells in another organism.
	GO:0051044	positive regulation of membrane protein ectodomain proteolysis	Any process that activates or increases the frequency, rate or extent of membrane protein ectodomain peptidolysis.
	GO:0045666	positive regulation of neuron differentiation	Any process that activates or increases the frequency, rate or extent of neuron differentiation.
	GO:0045429	positive regulation of nitric oxide biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of nitric oxide.
	GO:0045672	positive regulation of osteoclast differentiation	Any process that activates or increases the frequency, rate or extent of osteoclast differentiation.
	GO:0033141	positive regulation of peptidyl-serine phosphorylation of STAT protein	Any process that activates or increases the frequency, rate or extent of the phosphorylation of a serine residue of a STAT (Signal Transducer and Activator of Transcription) protein.
	GO:0034393	positive regulation of smooth muscle cell apoptotic process	Any process that activates or increases the frequency, rate, or extent of smooth muscle cell apoptotic process.
	GO:0032224	positive regulation of synaptic transmission, cholinergic	Any process that activates, maintains or increases the frequency, rate or extent of cholinergic synaptic transmission, the process of communication from a neuron to another neuron across a synapse using the neurotransmitter acetylcholine.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:2000309	positive regulation of tumor necrosis factor (ligand) superfamily member 11 production	Any process that activates or increases the frequency, rate or extent of tumor necrosis factor (ligand) superfamily member 11 production.
	GO:0032760	positive regulation of tumor necrosis factor production	Any process that activates or increases the frequency, rate, or extent of tumor necrosis factor production.
	GO:0060557	positive regulation of vitamin D biosynthetic process	Any process that increases the rate, frequency or extent of a vitamin D biosynthetic process. Vitamin D biosynthesis is the chemical reactions and pathways resulting in the formation of vitamin D, any of a group of related, fat-soluble compounds that are derived from delta-5,7 steroids and play a central role in calcium metabolism. Specific forms of vitamin D include calciferol (ergocalciferol; vitamin D2) and cholecalciferol (calciol; vitamin D3).
	GO:0000060	protein import into nucleus, translocation	A protein transport process that contributes to protein import into the nucleus, and that results in the vectorial transfer of a cargo-carrier protein complex through the nuclear pore complex from the cytoplasmic side to the nucleoplasmic side of the nuclear envelope.
	GO:0040008	regulation of growth	Any process that modulates the frequency, rate or extent of the growth of all or part of an organism so that it occurs at its proper speed, either globally or in a specific part of the organism's development.
	GO:2000345	regulation of hepatocyte proliferation	Any process that modulates the frequency, rate or extent of hepatocyte proliferation.
	GO:0050776	regulation of immune response	Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
	GO:0050796	regulation of insulin secretion	Any process that modulates the frequency, rate or extent of the regulated release of insulin.
	GO:0060334	regulation of interferon-gamma-mediated signaling pathway	Any process that modulates the rate, frequency or extent of the series of molecular events generated as a consequence of interferon-gamma binding to a cell surface receptor.
	GO:0098908	regulation of neuronal action potential	Any process that modulates the frequency, rate or extent of action potential creation, propagation or termination in a neuron. This typically occurs via modulation of the activity or expression of voltage-gated ion channels.
	GO:0002026	regulation of the force of heart contraction	Any process that modulates the extent of heart contraction, changing the force with which blood is propelled.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0009615	response to virus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus from a virus.
	GO:0050954	sensory perception of mechanical stimulus	The series of events required for an organism to receive a sensory mechanical stimulus, convert it to a molecular signal, and recognize and characterize the signal. This is a neurological process.
cellular component
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

Chain B,E (INGR1_HUMAN | P15260)

molecular function
	GO:0019955	cytokine binding	Interacting selectively and non-covalently with a cytokine, any of a group of proteins that function to control the survival, growth and differentiation of tissues and cells, and which have autocrine and paracrine activity.
	GO:0004906	interferon-gamma receptor activity	Combining with interferon-gamma (a type II interferon) and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0042015	interleukin-20 binding	Interacting selectively and non-covalently with interleukin-20.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0060333	interferon-gamma-mediated signaling pathway	A series of molecular signals initiated by the binding of interferon-gamma to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription. Interferon gamma is the only member of the type II interferon found so far.
	GO:0060334	regulation of interferon-gamma-mediated signaling pathway	Any process that modulates the rate, frequency or extent of the series of molecular events generated as a consequence of interferon-gamma binding to a cell surface receptor.
	GO:0009615	response to virus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus from a virus.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (6, 6)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (5, 10)

PROSITE Motifs (0, 0)

Exons (9, 18)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (2, 8)

Pfam Domains (0, 0)

Gene Ontology (90, 93)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File