Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A NATURALLY OCCURING PARALLEL RIGHT-HANDED COILED-COIL TETRAMER
 
Authors :  J. Stetefeld
Date :  21 Jul 00  (Deposition) - 21 Jan 01  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Right Handed Coiled Coil, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Stetefeld, M. Jenny, T. Schulthess, R. Landwehr, J. Engel, R. A. Kammerer
Crystal Structure Of A Naturally Occurring Parallel Right-Handed Coiled Coil Tetramer.
Nat. Struct. Biol. V. 7 772 2000
PubMed-ID: 10966648  |  Reference-DOI: 10.1038/79006
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TETRABRACHION
    ChainsA, B, C, D
    FragmentRIGHT HANDED COILED COIL
    Organism ScientificSTAPHYLOTHERMUS MARINUS
    Organism Taxid2280

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1FE6)

(-) Sites  (0, 0)

(no "Site" information available for 1FE6)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1FE6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1FE6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1FE6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1FE6)

(-) Exons   (0, 0)

(no "Exon" information available for 1FE6)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:52
 aligned with Q54436_STAMA | Q54436 from UniProtKB/TrEMBL  Length:1524

    Alignment length:67
                                  1231      1241      1251      1261      1271      1281       
        Q54436_STAMA   1222 GTLLFYMTANEQRLEGIINETADDIVYRLTVIIDDRYESLKNLITLRADRLEMIINDNVSTILASIG 1288
               SCOP domains d              1fe6a_ A: Tetrabrachion                              SCOP domains
               CATH domains 1              fe6A00 A:1-52 Tetrabrachion                          CATH domains
               Pfam domains ------------------------------------------------------------------- Pfam domains
         Sec.struct. author .--------------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh-h Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------- Transcript
                1fe6 A    1 G--------------SIINETADDIVYRLTVIIDDRYESLKNLITLRADRLEMIINDNVSTILAS-G   52
                            |        -     |   6        16        26        36        46    | |
                            |              2                                               51 |
                            1                                                                52

Chain B from PDB  Type:PROTEIN  Length:52
 aligned with Q54436_STAMA | Q54436 from UniProtKB/TrEMBL  Length:1524

    Alignment length:67
                                  1231      1241      1251      1261      1271      1281       
        Q54436_STAMA   1222 GTLLFYMTANEQRLEGIINETADDIVYRLTVIIDDRYESLKNLITLRADRLEMIINDNVSTILASIG 1288
               SCOP domains d              1fe6b_ B: Tetrabrachion                              SCOP domains
               CATH domains 1              fe6B00 B:1-52 Tetrabrachion                          CATH domains
               Pfam domains ------------------------------------------------------------------- Pfam domains
         Sec.struct. author .--------------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh-h Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------- Transcript
                1fe6 B    1 G--------------SIINETADDIVYRLTVIIDDRYESLKNLITLRADRLEMIINDNVSTILAS-G   52
                            |        -     |   6        16        26        36        46    | |
                            |              2                                               51 |
                            1                                                                52

Chain C from PDB  Type:PROTEIN  Length:49
 aligned with Q54436_STAMA | Q54436 from UniProtKB/TrEMBL  Length:1524

    Alignment length:50
                                  1248      1258      1268      1278      1288
        Q54436_STAMA   1239 INETADDIVYRLTVIIDDRYESLKNLITLRADRLEMIINDNVSTILASIG 1288
               SCOP domains d1fe6c_ C: Tetrabrachion                           SCOP domains
               CATH domains 1fe6C00 C:4-52 Tetrabrachion                       CATH domains
               Pfam domains -------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh-h Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------- Transcript
                1fe6 C    4 INETADDIVYRLTVIIDDRYESLKNLITLRADRLEMIINDNVSTILAS-G   52
                                    13        23        33        43       |52
                                                                          51 |
                                                                            52

Chain D from PDB  Type:PROTEIN  Length:52
 aligned with Q54436_STAMA | Q54436 from UniProtKB/TrEMBL  Length:1524

    Alignment length:67
                                  1231      1241      1251      1261      1271      1281       
        Q54436_STAMA   1222 GTLLFYMTANEQRLEGIINETADDIVYRLTVIIDDRYESLKNLITLRADRLEMIINDNVSTILASIG 1288
               SCOP domains d              1fe6d_ D: Tetrabrachion                              SCOP domains
               CATH domains 1              fe6D00 D:1-52 Tetrabrachion                          CATH domains
               Pfam domains ------------------------------------------------------------------- Pfam domains
         Sec.struct. author .--------------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.-. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------- Transcript
                1fe6 D    1 G--------------SIINETADDIVYRLTVIIDDRYESLKNLITLRADRLEMIINDNVSTILAS-G   52
                            |        -     |   6        16        26        36        46    | |
                            |              2                                               51 |
                            1                                                                52

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1FE6)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (Q54436_STAMA | Q54436)
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1fe6)
 
  Sites
(no "Sites" information available for 1fe6)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1fe6)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1fe6
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q54436_STAMA | Q54436
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q54436_STAMA | Q54436
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        Q54436_STAMA | Q544365jr5
UniProtKB/TrEMBL
        Q54436_STAMA | Q544361ybk

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1FE6)