Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  RHCC COCRYSTALLIZED WITH CAPB
 
Authors :  J. Stetefeld
Date :  21 Dec 04  (Deposition) - 18 Jan 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.45
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Right Hand Coiled Coil, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Ozbek, J. F. Muller, E. Figgemeier, J. Stetefeld
Favourable Mediation Of Crystal Contacts By Cocoamidopropylbetaine (Capb).
Acta Crystallogr. , Sect. D V. 61 477 2005
PubMed-ID: 15805603  |  Reference-DOI: 10.1107/S0907444905001204
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TETRABRACHION
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificSTAPHYLOTHERMUS MARINUS
    Organism Taxid2280

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric/Biological Unit (2, 4)
No.NameCountTypeFull Name
1BEQ1Ligand/IonN-(CARBOXYMETHYL)-N,N-DIMETHYL-3-[(1-OXODODECYL)AMINO]-1-PROPANAMINIUM INNER SALT
2SO43Ligand/IonSULFATE ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER D:25 , ASN D:28 , HOH D:607 , HOH D:619 , HOH D:674BINDING SITE FOR RESIDUE SO4 D 601
2AC2SOFTWARESER A:25 , ASN A:28 , HOH A:604 , HOH A:610 , HOH A:662 , HOH A:682BINDING SITE FOR RESIDUE SO4 A 602
3AC3SOFTWAREGLY A:1 , ASN A:5 , GLU A:6 , HOH A:719 , HOH A:725 , HOH A:733 , ARG B:36 , HOH B:699BINDING SITE FOR RESIDUE SO4 B 603
4AC4SOFTWAREARG A:36 , MET A:39 , ILE A:40 , HOH A:622 , SER C:25 , ASN C:28 , LEU C:29 , LEU C:32 , ARG C:33 , HOH C:703 , HOH C:718 , HOH C:724BINDING SITE FOR RESIDUE BEQ C 701

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1YBK)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1YBK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1YBK)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1YBK)

(-) Exons   (0, 0)

(no "Exon" information available for 1YBK)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:52
 aligned with Q54436_STAMA | Q54436 from UniProtKB/TrEMBL  Length:1524

    Alignment length:66
                                  1231      1241      1251      1261      1271      1281      
        Q54436_STAMA   1222 GTLLFYMTANEQRLEGIINETADDIVYRLTVIIDDRYESLKNLITLRADRLEMIINDNVSTILASI 1287
               SCOP domains d              1ybka_ A: automated matches                         SCOP domains
               CATH domains 1              ybkA00 A:1-52 Tetrabrachion                         CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author .--------------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                1ybk A    1 G--------------SIINETADDIVYRLTVIIDDRYESLKNLITLRADRLEMIINDNVSTILASI   52
                            |        -     |   6        16        26        36        46      
                            |              2                                                  
                            1                                                                 

Chain B from PDB  Type:PROTEIN  Length:52
 aligned with Q54436_STAMA | Q54436 from UniProtKB/TrEMBL  Length:1524

    Alignment length:66
                                  1231      1241      1251      1261      1271      1281      
        Q54436_STAMA   1222 GTLLFYMTANEQRLEGIINETADDIVYRLTVIIDDRYESLKNLITLRADRLEMIINDNVSTILASI 1287
               SCOP domains d              1ybkb_ B: automated matches                         SCOP domains
               CATH domains 1              ybkB00 B:1-52 Tetrabrachion                         CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author .--------------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                1ybk B    1 G--------------SIINETADDIVYRLTVIIDDRYESLKNLITLRADRLEMIINDNVSTILASI   52
                            |        -     |   6        16        26        36        46      
                            1              2                                                  

Chain C from PDB  Type:PROTEIN  Length:49
 aligned with Q54436_STAMA | Q54436 from UniProtKB/TrEMBL  Length:1524

    Alignment length:49
                                  1248      1258      1268      1278         
        Q54436_STAMA   1239 INETADDIVYRLTVIIDDRYESLKNLITLRADRLEMIINDNVSTILASI 1287
               SCOP domains d1ybkc_ C: automated matches                      SCOP domains
               CATH domains 1ybkC00 C:4-52 Tetrabrachion                      CATH domains
               Pfam domains ------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------- Transcript
                1ybk C    4 INETADDIVYRLTVIIDDRYESLKNLITLRADRLEMIINDNVSTILASI   52
                                    13        23        33        43         

Chain D from PDB  Type:PROTEIN  Length:52
 aligned with Q54436_STAMA | Q54436 from UniProtKB/TrEMBL  Length:1524

    Alignment length:66
                                  1231      1241      1251      1261      1271      1281      
        Q54436_STAMA   1222 GTLLFYMTANEQRLEGIINETADDIVYRLTVIIDDRYESLKNLITLRADRLEMIINDNVSTILASI 1287
               SCOP domains d              1ybkd_ D: automated matches                         SCOP domains
               CATH domains 1              ybkD00 D:1-52 Tetrabrachion                         CATH domains
           Pfam domains (1) ----------------Tetrabrachion-1ybkD01 D:3-51                     - Pfam domains (1)
           Pfam domains (2) ----------------Tetrabrachion-1ybkD02 D:3-51                     - Pfam domains (2)
           Pfam domains (3) ----------------Tetrabrachion-1ybkD03 D:3-51                     - Pfam domains (3)
           Pfam domains (4) ----------------Tetrabrachion-1ybkD04 D:3-51                     - Pfam domains (4)
         Sec.struct. author .--------------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                1ybk D    1 G--------------SIINETADDIVYRLTVIIDDRYESLKNLITLRADRLEMIINDNVSTILASI   52
                            |        -     |   6        16        26        36        46      
                            1              2                                                  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit

(-) Pfam Domains  (1, 4)

Asymmetric/Biological Unit

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (Q54436_STAMA | Q54436)
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BEQ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ybk)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ybk
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q54436_STAMA | Q54436
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q54436_STAMA | Q54436
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        Q54436_STAMA | Q544365jr5
UniProtKB/TrEMBL
        Q54436_STAMA | Q544361fe6

(-) Related Entries Specified in the PDB File

1fe6