Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  THE STRUCTURE OF FLAVOCYTOCHROME C SULFIDE DEHYDROGENASE FROM A PURPLE PHOTOTROPHIC BACTERIUM CHROMATIUM VINOSUM AT 2.5 ANGSTROMS RESOLUTION
 
Authors :  Z. W. Chen, M. Koh, G. Van Driessche, J. J. Van Beeumen, R. G. Bartsch, T. E. Meyer, M. A. Cusanovich, F. S. Mathews
Date :  18 Aug 94  (Deposition) - 01 Nov 94  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.53
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,C  (1x)
Biol. Unit 2:  B,D  (1x)
Keywords :  Electron Transport(Flavocytochrome) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Z. W. Chen, M. Koh, G. Van Driessche, J. J. Van Beeumen, R. G. Bartsch, T. E. Meyer, M. A. Cusanovich, F. S. Mathews
The Structure Of Flavocytochrome C Sulfide Dehydrogenase From A Purple Phototrophic Bacterium.
Science V. 266 430 1994
PubMed-ID: 7939681
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - FLAVOCYTOCHROME C SULFIDE DEHYDROGENASE (FLAVIN- BINDING SUBUNIT)
    Chains: A, B
    Engineered: YES
    Organism Scientific: ALLOCHROMATIUM VINOSUM
    Organism Taxid: 1049
 
Molecule 2 - FLAVOCYTOCHROME C SULFIDE DEHYDROGENASE (CYTOCHROME SUBUNIT)
    Chains: C, D
    Engineered: YES
    Organism Scientific: ALLOCHROMATIUM VINOSUM
    Organism Taxid: 1049

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A C 
Biological Unit 2 (1x):  B D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 6)

Asymmetric Unit (2, 6)
No.NameCountTypeFull Name
1FAD2Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
2HEM4Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
Biological Unit 1 (2, 3)
No.NameCountTypeFull Name
1FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
2HEM2Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
Biological Unit 2 (2, 3)
No.NameCountTypeFull Name
1FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
2HEM2Ligand/IonPROTOPORPHYRIN IX CONTAINING FE

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREVAL A:8 , GLY A:9 , GLY A:11 , GLY A:13 , ILE A:33 , GLU A:34 , PRO A:35 , TYR A:39 , CYS A:42 , TYR A:43 , ASN A:46 , ALA A:77 , ALA A:103 , PRO A:104 , GLY A:105 , TRP A:128 , ARG A:160 , CYS A:161 , ILE A:261 , GLY A:293 , ASP A:294 , SER A:304 , GLY A:305 , TYR A:306 , TYR A:338 , TRP A:391BINDING SITE FOR RESIDUE FAD A 699
2AC2SOFTWARETYR A:306 , THR A:336 , TYR A:338 , TYR A:387 , CYS C:11 , CYS C:14 , HIS C:15 , PRO C:27 , ILE C:29 , PHE C:37 , MET C:41 , PHE C:44 , SER C:51 , THR C:52 , ILE C:53 , MET C:54 , TYR C:61 , TYR C:128 , HEM C:902BINDING SITE FOR RESIDUE HEM C 901
3AC3SOFTWARETYR C:100 , CYS C:101 , CYS C:104 , HIS C:105 , HIS C:119 , TYR C:128 , ARG C:141 , PRO C:142 , GLU C:144 , MET C:147 , LEU C:155 , LEU C:166 , HEM C:901BINDING SITE FOR RESIDUE HEM C 902
4AC4SOFTWAREVAL B:8 , GLY B:9 , GLY B:11 , THR B:12 , GLY B:13 , ILE B:33 , GLU B:34 , PRO B:35 , TYR B:39 , CYS B:42 , TYR B:43 , ASN B:46 , ALA B:77 , ALA B:103 , PRO B:104 , GLY B:105 , ARG B:160 , CYS B:161 , GLY B:293 , ASP B:294 , LYS B:303 , SER B:304 , GLY B:305 , TYR B:306 , TYR B:338 , TRP B:391BINDING SITE FOR RESIDUE FAD B 699
5AC5SOFTWARETYR B:306 , LEU B:334 , THR B:336 , TYR B:387 , CYS D:11 , CYS D:14 , HIS D:15 , ILE D:29 , MET D:32 , PHE D:37 , MET D:41 , PHE D:44 , SER D:51 , THR D:52 , ILE D:53 , MET D:54 , ILE D:57 , TYR D:61 , TYR D:128 , HEM D:902BINDING SITE FOR RESIDUE HEM D 901
6AC6SOFTWARETYR D:100 , CYS D:101 , LYS D:103 , CYS D:104 , HIS D:105 , HIS D:119 , TYR D:128 , MET D:133 , PHE D:136 , ARG D:141 , PRO D:142 , GLU D:144 , LYS D:146 , MET D:147 , HEM D:901BINDING SITE FOR RESIDUE HEM D 902

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1A:161 -A:337
2B:161 -B:337

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Gly A:222 -Pro A:223
2Gly C:23 -Pro C:24
3Gly B:222 -Pro B:223
4Gly D:23 -Pro D:24

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1FCD)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYTCPS51007 Cytochrome c family profile.CYSD_ALLVD23-102
113-199
 		  2-
C:88-174
D:88-174
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYTCPS51007 Cytochrome c family profile.CYSD_ALLVD23-102
113-199
 		  1-
C:88-174
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYTCPS51007 Cytochrome c family profile.CYSD_ALLVD23-102
113-199
 		  1-
-
D:88-174

(-) Exons   (0, 0)

(no "Exon" information available for 1FCD)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:401
 aligned with DHSU_ALLVD | Q06530 from UniProtKB/Swiss-Prot  Length:431

    Alignment length:401
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430 
           DHSU_ALLVD    31 AGRKVVVVGGGTGGATAAKYIKLADPSIEVTLIEPNTDYYTCYLSNEVIGGDRKLESIKHGYDGLRAHGIQVVHDSATGIDPDKKLVKTAGGAEFGYDRCVVAPGIELIYDKIEGYSEEAAAKLPHAWKAGEQTAILRKQLEDMADGGTVVIAPPAAPFRCPPGPYERASQVAYYLKAHKPKSKVIILDSSQTFSKQSQFSKGWERLYGFGTENAMIEWHPGPDSAVVKVDGGEMMVETAFGDEFKADVINLIPPQRAGKIAQIAGLTNDAGWCPVDIKTFESSIHKGIHVIGDACIANPMPKSGYSANSQGKVAAAAVVALLKGEEPGTPSYLNTCYSILAPAYGISVAAIYRPNADGSAIESVPDSGGVTPVDAPDWVLEREVQYAYSWYNNIVHDTFG 431
               SCOP domains d1fcda1 A:1-114,A:256-327 Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit                   d1fcda2 A:115-255 Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit                                                      d1fcda1 A:1-114,A:256-327                                               d1fcda3 A:328-401                                                          SCOP domains
               CATH domains 1fcdA01 A:1-116,A:256-327  [code=3.50.50.60, no name defined]                                                       1fcdA02 A:117-255  [code=3.50.50.60, no name defined]                                                                                      1fcdA01 A:1-116,A:256-327  [code=3.50.50.60, no name defined]           1fcdA03 A:328-401                                                          CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author eeeeeeeeeehhhhhhhhhhhhhhhheeeeeeeee..eee...hhhhhhh...hhhhheeehhhhhhhheeeeeeeeeeeee..eeeeee..eeee..eeeeeeeeeeee..eee.hhhhhhheee...hhhhhhhhhhhhhhh..eeeeeeeee.......hhhhhhhhhhhhhhhhhhheeeeeeeeee....hhhhhhhhhhhhh.......eeeeeee.......eee..eeeee..eeeeeeeeeeeeeeeeehhhhhhhheee..eee.eee..eee....eeeeeee.........hhhhhhhhhhhhhhhhhhhhhh......eeeeeeeeeee..eeeeeeeeeeee....eeee....eeee....hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1fcd A   1 AGRKVVVVGGGTGGATAAKYIKLADPSIEVTLIEPNTDYYTCYLSNEVIGGDRKLESIKHGYDGLRAHGIQVVHDSATGIDPDKKLVKTAGGAEFGYDRCVVAPGIELIYDKIEGYSEEAAAKLPHAWKAGEQTAILRKQLEDMADGGTVVIAPPAAPFRCPPGPYERASQVAYYLKAHKPMSKVIILDSSQTFSKQSQFSKGWERLYGFGTENAMIEWHPGPDSAVVKVDGGEMMVETAFGDEFKADVINLIPPQRAGKIAQIAGLTNDAGWCPVDIKTFESSIHKGIHVIGDASIANPMPKSGYSANSQGKVAAAAVVVLLKGEEPGTPSYLNTCYSILAPAYGISVAAIYRPNADGSAIESVPDSGGVTPVDAPDWVLEREVQYAYSWYNNIVHDTFG 401
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400 


Chain B from PDB  Type:PROTEIN  Length:401
 aligned with DHSU_ALLVD | Q06530 from UniProtKB/Swiss-Prot  Length:431

    Alignment length:401
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430 
           DHSU_ALLVD    31 AGRKVVVVGGGTGGATAAKYIKLADPSIEVTLIEPNTDYYTCYLSNEVIGGDRKLESIKHGYDGLRAHGIQVVHDSATGIDPDKKLVKTAGGAEFGYDRCVVAPGIELIYDKIEGYSEEAAAKLPHAWKAGEQTAILRKQLEDMADGGTVVIAPPAAPFRCPPGPYERASQVAYYLKAHKPKSKVIILDSSQTFSKQSQFSKGWERLYGFGTENAMIEWHPGPDSAVVKVDGGEMMVETAFGDEFKADVINLIPPQRAGKIAQIAGLTNDAGWCPVDIKTFESSIHKGIHVIGDACIANPMPKSGYSANSQGKVAAAAVVALLKGEEPGTPSYLNTCYSILAPAYGISVAAIYRPNADGSAIESVPDSGGVTPVDAPDWVLEREVQYAYSWYNNIVHDTFG 431
               SCOP domains d1fcdb1 B:1-114,B:256-327 Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit                   d1fcdb2 B:115-255 Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit                                                      d1fcdb1 B:1-114,B:256-327                                               d1fcdb3 B:328-401                                                          SCOP domains
               CATH domains 1fcdB01 B:1-116,B:256-327  [code=3.50.50.60, no name defined]                                                       1fcdB02 B:117-255  [code=3.50.50.60, no name defined]                                                                                      1fcdB01 B:1-116,B:256-327  [code=3.50.50.60, no name defined]           1fcdB03 B:328-401                                                          CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author eeeeeeeeeehhhhhhhhhhhhhhhheeeeeeeee..eee...hhhhhhh...hhhhheeehhhhhhhheeeeeeeeeeeee..eeeeee..eeee..eeeeeeeeeeee..eee.hhhhhhheee...hhhhhhhhhhhhhhh..eeeeeeeee.......hhhhhhhhhhhhhhhhhhheeeeeeeeee....hhhhhhhhhhhhh.......eeeeeee.......eee..eeeee..eeeeeeeeeeeeeeeeehhhhhhhheee..eee.eee..eee....eeeeeee.........hhhhhhhhhhhhhhhhhhhhhh......eeeeeeeeeee..eeeeeeeeeeee....eeee....eeee....hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1fcd B   1 AGRKVVVVGGGTGGATAAKYIKLADPSIEVTLIEPNTDYYTCYLSNEVIGGDRKLESIKHGYDGLRAHGIQVVHDSATGIDPDKKLVKTAGGAEFGYDRCVVAPGIELIYDKIEGYSEEAAAKLPHAWKAGEQTAILRKQLEDMADGGTVVIAPPAAPFRCPPGPYERASQVAYYLKAHKPMSKVIILDSSQTFSKQSQFSKGWERLYGFGTENAMIEWHPGPDSAVVKVDGGEMMVETAFGDEFKADVINLIPPQRAGKIAQIAGLTNDAGWCPVDIKTFESSIHKGIHVIGDASIANPMPKSGYSANSQGKVAAAAVVVLLKGEEPGTPSYLNTCYSILAPAYGISVAAIYRPNADGSAIESVPDSGGVTPVDAPDWVLEREVQYAYSWYNNIVHDTFG 401
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400 


Chain C from PDB  Type:PROTEIN  Length:174
 aligned with CYSD_ALLVD | Q06529 from UniProtKB/Swiss-Prot  Length:199

    Alignment length:174
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195    
           CYSD_ALLVD    26 EPTAEMLTNNCAGCHGTHGNSVGPASPSIAQMDPMVFVEVMEGFKSGEIASTIMGRIAKGYSTADFEKMAGYFKQQTYQPAKQSFDTALADTGAKLHDKYCEKCHVEGGKPLADEEDYHILAGQWTPYLQYAMSDFREERRPMEKKMASKLRELLKAEGDAGLDALFAFYASQQ 199
               SCOP domains d1fcdc1 C:1-80 Flavocytochrome c sulfide dehydrogenase, FCSD, cytochrome subunitd1fcdc2 C:81-174 Flavocytochrome c sulfide dehydrogenase, FCSD, cytochrome subunit             SCOP domains
               CATH domains 1fcdC01 C:1-78 Cytochrome c                                                   1fcdC02 C:79-174 Cytochrome c                                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhh....................hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhh.......................hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE CYTC  PDB: - UniProt: 23-102                                                 ----------CYTC  PDB: C:88-174 UniProt: 113-199                                                    PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1fcd C   1 EPTAEMLTNNCAGCHGTHGNSVGPASPSIAQMDPMVFVEVMEGFKSGEIASTIMGRIAKGYSTADFEKMAGYFKQQTYQPAKQSFDTALADTGAKLHDKYCEKCHVEGGKPLADEEDYHILAGQWTPYLQYAMSDFREERRPMEKKMASKLRELLKAEGDAGLDALFAFYASQQ 174
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170    


Chain D from PDB  Type:PROTEIN  Length:174
 aligned with CYSD_ALLVD | Q06529 from UniProtKB/Swiss-Prot  Length:199

    Alignment length:174
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195    
           CYSD_ALLVD    26 EPTAEMLTNNCAGCHGTHGNSVGPASPSIAQMDPMVFVEVMEGFKSGEIASTIMGRIAKGYSTADFEKMAGYFKQQTYQPAKQSFDTALADTGAKLHDKYCEKCHVEGGKPLADEEDYHILAGQWTPYLQYAMSDFREERRPMEKKMASKLRELLKAEGDAGLDALFAFYASQQ 199
               SCOP domains d1fcdd1 D:1-80 Flavocytochrome c sulfide dehydrogenase, FCSD, cytochrome subunitd1fcdd2 D:81-174 Flavocytochrome c sulfide dehydrogenase, FCSD, cytochrome subunit             SCOP domains
               CATH domains 1fcdD01 D:1-78 Cytochrome c                                                   1fcdD02 D:79-174 Cytochrome c                                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhh....................hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhh.......................hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE CYTC  PDB: - UniProt: 23-102                                                 ----------CYTC  PDB: D:88-174 UniProt: 113-199                                                    PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1fcd D   1 EPTAEMLTNNCAGCHGTHGNSVGPASPSIAQMDPMVFVEVMEGFKSGEIASTIMGRIAKGYSTADFEKMAGYFKQQTYQPAKQSFDTALADTGAKLHDKYCEKCHVEGGKPLADEEDYHILAGQWTPYLQYAMSDFREERRPMEKKMASKLRELLKAEGDAGLDALFAFYASQQ 174
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 10)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)
(-)
Class: Alpha and beta proteins (a+b) (23004)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (3, 10)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1FCD)

(-) Gene Ontology  (8, 10)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (DHSU_ALLVD | Q06530)
molecular function
    GO:0050660    flavin adenine dinucleotide binding    Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0042597    periplasmic space    The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

Chain C,D   (CYSD_ALLVD | Q06529)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0042597    periplasmic space    The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:222 - Pro A:223   [ RasMol ]  
    Gly B:222 - Pro B:223   [ RasMol ]  
    Gly C:23 - Pro C:24   [ RasMol ]  
    Gly D:23 - Pro D:24   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1fcd
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CYSD_ALLVD | Q06529
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  DHSU_ALLVD | Q06530
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CYSD_ALLVD | Q06529
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  DHSU_ALLVD | Q06530
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1FCD)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1FCD)