1FB1 - JenaLib

Asymmetric Unit (39, 195)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_016888	L	71	Q	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	L	71	Q
02	UniProt	VAR_016889	A	74	V	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	A	74	V
03	UniProt	VAR_072733	Y	75	C	GCH1_HUMAN	Unclassified	---	A/B/C/D/E	Y	75	C
04	UniProt	VAR_002634	L	79	P	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	L	79	P
05	UniProt	VAR_016890	G	83	A	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	G	83	A
06	UniProt	VAR_002635	R	88	P	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	R	88	P
07	UniProt	VAR_002636	R	88	W	GCH1_HUMAN	Disease (DRD)	104894433	A/B/C/D/E	R	88	W
08	UniProt	VAR_016892	G	90	V	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	G	90	V
09	UniProt	VAR_072734	A	98	V	GCH1_HUMAN	Polymorphism	---	A/B/C/D/E	A	98	V
10	UniProt	VAR_002637	M	102	K	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	M	102	K
11	UniProt	VAR_016893	M	102	R	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	M	102	R
12	UniProt	VAR_054112	T	106	I	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	T	106	I
13	UniProt	VAR_016894	G	108	D	GCH1_HUMAN	Disease (HPABH4B)	104894435	A/B/C/D/E	G	108	D
14	UniProt	VAR_016895	D	115	N	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	D	115	N
15	UniProt	VAR_002638	D	134	V	GCH1_HUMAN	Disease (DRD)	104894437	A/B/C/D/E	D	134	V
16	UniProt	VAR_016896	I	135	K	GCH1_HUMAN	Disease (DRD)	104894441	A/B/C/D/E	I	135	K
17	UniProt	VAR_072735	I	135	T	GCH1_HUMAN	Polymorphism	---	A/B/C/D/E	I	135	T
18	UniProt	VAR_016897	C	141	R	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	C	141	R
19	UniProt	VAR_002639	C	141	W	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	C	141	W
20	UniProt	VAR_002640	H	144	P	GCH1_HUMAN	Disease (DRD)	104894440	A/B/C/D/E	H	144	P
21	UniProt	VAR_002641	H	153	P	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	H	153	P
22	UniProt	VAR_016898	L	163	R	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	L	163	R
23	UniProt	VAR_016899	S	176	T	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	S	176	T
24	UniProt	VAR_002642	R	178	S	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	R	178	S
25	UniProt	VAR_016900	Q	180	R	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	Q	180	R
26	UniProt	VAR_002643	R	184	H	GCH1_HUMAN	Disease (HPABH4B)	104894445	A/B/C/D/E	R	184	H
27	UniProt	VAR_002644	T	186	K	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	T	186	K
28	UniProt	VAR_016901	V	191	I	GCH1_HUMAN	Disease (DRD)	762208304	A/B/C/D/E	V	191	I
29	UniProt	VAR_016902	P	199	L	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	P	199	L
30	UniProt	VAR_002645	G	201	E	GCH1_HUMAN	Disease (DRD)	104894438	A/B/C/D/E	G	201	E
31	UniProt	VAR_002646	G	203	R	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	G	203	R
32	UniProt	VAR_002647	M	211	I	GCH1_HUMAN	Disease (HPABH4B)	104894443	A/B/C/D/E	M	211	I
33	UniProt	VAR_016903	M	211	V	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	M	211	V
34	UniProt	VAR_016904	M	213	V	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	M	213	V
35	UniProt	VAR_016905	M	221	T	GCH1_HUMAN	Disease (HPABH4B)	104894434	A/B/C/D/E	M	221	T
36	UniProt	VAR_002648	K	224	R	GCH1_HUMAN	Disease (HPABH4B)	41298442	A/B/C/D/E	K	224	R
37	UniProt	VAR_002649	F	234	S	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	F	234	S
38	UniProt	VAR_016906	R	241	W	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	R	241	W
39	UniProt	VAR_016907	R	249	S	GCH1_HUMAN	Disease (DRD)	104894442	A/B/C/D/E	R	249	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (39, 390)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_016888	L	71	Q	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	L	71	Q
02	UniProt	VAR_016889	A	74	V	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	A	74	V
03	UniProt	VAR_072733	Y	75	C	GCH1_HUMAN	Unclassified	---	A/B/C/D/E	Y	75	C
04	UniProt	VAR_002634	L	79	P	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	L	79	P
05	UniProt	VAR_016890	G	83	A	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	G	83	A
06	UniProt	VAR_002635	R	88	P	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	R	88	P
07	UniProt	VAR_002636	R	88	W	GCH1_HUMAN	Disease (DRD)	104894433	A/B/C/D/E	R	88	W
08	UniProt	VAR_016892	G	90	V	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	G	90	V
09	UniProt	VAR_072734	A	98	V	GCH1_HUMAN	Polymorphism	---	A/B/C/D/E	A	98	V
10	UniProt	VAR_002637	M	102	K	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	M	102	K
11	UniProt	VAR_016893	M	102	R	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	M	102	R
12	UniProt	VAR_054112	T	106	I	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	T	106	I
13	UniProt	VAR_016894	G	108	D	GCH1_HUMAN	Disease (HPABH4B)	104894435	A/B/C/D/E	G	108	D
14	UniProt	VAR_016895	D	115	N	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	D	115	N
15	UniProt	VAR_002638	D	134	V	GCH1_HUMAN	Disease (DRD)	104894437	A/B/C/D/E	D	134	V
16	UniProt	VAR_016896	I	135	K	GCH1_HUMAN	Disease (DRD)	104894441	A/B/C/D/E	I	135	K
17	UniProt	VAR_072735	I	135	T	GCH1_HUMAN	Polymorphism	---	A/B/C/D/E	I	135	T
18	UniProt	VAR_016897	C	141	R	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	C	141	R
19	UniProt	VAR_002639	C	141	W	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	C	141	W
20	UniProt	VAR_002640	H	144	P	GCH1_HUMAN	Disease (DRD)	104894440	A/B/C/D/E	H	144	P
21	UniProt	VAR_002641	H	153	P	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	H	153	P
22	UniProt	VAR_016898	L	163	R	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	L	163	R
23	UniProt	VAR_016899	S	176	T	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	S	176	T
24	UniProt	VAR_002642	R	178	S	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	R	178	S
25	UniProt	VAR_016900	Q	180	R	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	Q	180	R
26	UniProt	VAR_002643	R	184	H	GCH1_HUMAN	Disease (HPABH4B)	104894445	A/B/C/D/E	R	184	H
27	UniProt	VAR_002644	T	186	K	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	T	186	K
28	UniProt	VAR_016901	V	191	I	GCH1_HUMAN	Disease (DRD)	762208304	A/B/C/D/E	V	191	I
29	UniProt	VAR_016902	P	199	L	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	P	199	L
30	UniProt	VAR_002645	G	201	E	GCH1_HUMAN	Disease (DRD)	104894438	A/B/C/D/E	G	201	E
31	UniProt	VAR_002646	G	203	R	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	G	203	R
32	UniProt	VAR_002647	M	211	I	GCH1_HUMAN	Disease (HPABH4B)	104894443	A/B/C/D/E	M	211	I
33	UniProt	VAR_016903	M	211	V	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	M	211	V
34	UniProt	VAR_016904	M	213	V	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	M	213	V
35	UniProt	VAR_016905	M	221	T	GCH1_HUMAN	Disease (HPABH4B)	104894434	A/B/C/D/E	M	221	T
36	UniProt	VAR_002648	K	224	R	GCH1_HUMAN	Disease (HPABH4B)	41298442	A/B/C/D/E	K	224	R
37	UniProt	VAR_002649	F	234	S	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	F	234	S
38	UniProt	VAR_016906	R	241	W	GCH1_HUMAN	Disease (DRD)	---	A/B/C/D/E	R	241	W
39	UniProt	VAR_016907	R	249	S	GCH1_HUMAN	Disease (DRD)	104894442	A/B/C/D/E	R	249	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (2, 10)

Exons (6, 30)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:196
 aligned with GCH1_HUMAN | P30793 from UniProtKB/Swiss-Prot  Length:250

    Alignment length:196
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244      
           GCH1_HUMAN    55 GERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS 250
               SCOP domains d1fb1a_ A: GTP cyclohydrolase I                                                                                                                                                                      SCOP domains
               CATH domains --1fb1A01 A:57-116  [code=1.10.286.10, no name defined]       1fb1A02 A:117-250  [code=3.30.1130.10, no name defined]                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh...hhhhh..................eeeeeeeeeeee.....eeeeeeeeee.......hhhhhhhhhhhhhh.eehhhhhhhhhhhhhhhhhh...eeeeeeeeehhhhh........eeeeeee.hhhhhhhhhhhhhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) ----------------Q--VC---P---A----P-V-------V---K---I-D------N------------------VK-----R--P--------P---------R------------T-S-R---H-K----I-------L-E-R-------I-V-------T--R---------S------W-------S- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------W-------------R--------------------------------T-----W---------------------------------------------------------------------V--------------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------GTP_CYCLOHYDROL_1-------------------------------GTP_CYCLOHY---------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: A:55-115 UniProt: 1-115 [INCOMPLETE]         ------------------------------------Exon 1.3           ----------Exon 1.5  PDB: A:181-209     ----------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------Exon 1.2  PDB: A:115-151             ------------------Exon 1.4    ---------------------------Exon 1.6a  PDB: A:209-250 UniProt: 209-250 Transcript 1 (2)
                 1fb1 A  55 GERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS 250
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244

Chain B from PDB  Type:PROTEIN  Length:196
 aligned with GCH1_HUMAN | P30793 from UniProtKB/Swiss-Prot  Length:250

    Alignment length:196
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244      
           GCH1_HUMAN    55 GERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS 250
               SCOP domains d1fb1b_ B: GTP cyclohydrolase I                                                                                                                                                                      SCOP domains
               CATH domains --1fb1B01 B:57-116  [code=1.10.286.10, no name defined]       1fb1B02 B:117-250  [code=3.30.1130.10, no name defined]                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhh.hhhhhhhhhhh............eeeeeeeeeeee.....eeeeeeeeee.......hhhhhhhhhhhhhh.eehhhhhhhhhhhhhhhhhh..eeeeeeeeee.............eeee..eee....hhhhhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) ----------------Q--VC---P---A----P-V-------V---K---I-D------N------------------VK-----R--P--------P---------R------------T-S-R---H-K----I-------L-E-R-------I-V-------T--R---------S------W-------S- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------W-------------R--------------------------------T-----W---------------------------------------------------------------------V--------------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------GTP_CYCLOHYDROL_1-------------------------------GTP_CYCLOHY---------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: B:55-115 UniProt: 1-115 [INCOMPLETE]         ------------------------------------Exon 1.3           ----------Exon 1.5  PDB: B:181-209     ----------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------Exon 1.2  PDB: B:115-151             ------------------Exon 1.4    ---------------------------Exon 1.6a  PDB: B:209-250 UniProt: 209-250 Transcript 1 (2)
                 1fb1 B  55 GERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS 250
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244

Chain C from PDB  Type:PROTEIN  Length:196
 aligned with GCH1_HUMAN | P30793 from UniProtKB/Swiss-Prot  Length:250

    Alignment length:196
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244      
           GCH1_HUMAN    55 GERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS 250
               SCOP domains d1fb1c_ C: GTP cyclohydrolase I                                                                                                                                                                      SCOP domains
               CATH domains --1fb1C01 C:57-116  [code=1.10.286.10, no name defined]       1fb1C02 C:117-250  [code=3.30.1130.10, no name defined]                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhh.....hhhhhh............eeeeeeeeeeee.....eeeeeeeeee.......hhhhhhhhhhhhhh.eehhhhhhhhhhhhhhhhhh...eeeeeeeeehhhhh........eeeeeeehhhhhhhhhhhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) ----------------Q--VC---P---A----P-V-------V---K---I-D------N------------------VK-----R--P--------P---------R------------T-S-R---H-K----I-------L-E-R-------I-V-------T--R---------S------W-------S- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------W-------------R--------------------------------T-----W---------------------------------------------------------------------V--------------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------GTP_CYCLOHYDROL_1-------------------------------GTP_CYCLOHY---------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: C:55-115 UniProt: 1-115 [INCOMPLETE]         ------------------------------------Exon 1.3           ----------Exon 1.5  PDB: C:181-209     ----------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------Exon 1.2  PDB: C:115-151             ------------------Exon 1.4    ---------------------------Exon 1.6a  PDB: C:209-250 UniProt: 209-250 Transcript 1 (2)
                 1fb1 C  55 GERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS 250
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244

Chain D from PDB  Type:PROTEIN  Length:196
 aligned with GCH1_HUMAN | P30793 from UniProtKB/Swiss-Prot  Length:250

    Alignment length:196
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244      
           GCH1_HUMAN    55 GERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS 250
               SCOP domains d1fb1d_ D: GTP cyclohydrolase I                                                                                                                                                                      SCOP domains
               CATH domains --1fb1D01 D:57-116  [code=1.10.286.10, no name defined]       1fb1D02 D:117-250  [code=3.30.1130.10, no name defined]                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhh.....hhhhhh............eeeeeeeeeeee.....eeeeeeeeee.......hhhhhhhhhhhhhh.eehhhhhhhhhhhhhhhhhh..eeeeeeeeeehhhhh.........eeeeeeeehhhhhhhhhhhhh..... Sec.struct. author
             SAPs(SNPs) (1) ----------------Q--VC---P---A----P-V-------V---K---I-D------N------------------VK-----R--P--------P---------R------------T-S-R---H-K----I-------L-E-R-------I-V-------T--R---------S------W-------S- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------W-------------R--------------------------------T-----W---------------------------------------------------------------------V--------------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------GTP_CYCLOHYDROL_1-------------------------------GTP_CYCLOHY---------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: D:55-115 UniProt: 1-115 [INCOMPLETE]         ------------------------------------Exon 1.3           ----------Exon 1.5  PDB: D:181-209     ----------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------Exon 1.2  PDB: D:115-151             ------------------Exon 1.4    ---------------------------Exon 1.6a  PDB: D:209-250 UniProt: 209-250 Transcript 1 (2)
                 1fb1 D  55 GERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS 250
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244

Chain E from PDB  Type:PROTEIN  Length:196
 aligned with GCH1_HUMAN | P30793 from UniProtKB/Swiss-Prot  Length:250

    Alignment length:196
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244      
           GCH1_HUMAN    55 GERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS 250
               SCOP domains d1fb1e_ E: GTP cyclohydrolase I                                                                                                                                                                      SCOP domains
               CATH domains --1fb1E01 E:57-116  [code=1.10.286.10, no name defined]       1fb1E02 E:117-250  [code=3.30.1130.10, no name defined]                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhh.....hhhhhh............eeeeeeeeeeee.....eeeeeeeeee.......hhhhhhhhhhhhhh.eehhhhhhhhhhhhhhhhhh..eeeeeeeeeehhhhh........eeeeeeeeehhhhhhhhhhhhhh.... Sec.struct. author
             SAPs(SNPs) (1) ----------------Q--VC---P---A----P-V-------V---K---I-D------N------------------VK-----R--P--------P---------R------------T-S-R---H-K----I-------L-E-R-------I-V-------T--R---------S------W-------S- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------W-------------R--------------------------------T-----W---------------------------------------------------------------------V--------------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------GTP_CYCLOHYDROL_1-------------------------------GTP_CYCLOHY---------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: E:55-115 UniProt: 1-115 [INCOMPLETE]         ------------------------------------Exon 1.3           ----------Exon 1.5  PDB: E:181-209     ----------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------Exon 1.2  PDB: E:115-151             ------------------Exon 1.4    ---------------------------Exon 1.6a  PDB: E:209-250 UniProt: 209-250 Transcript 1 (2)
                 1fb1 E  55 GERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS 250
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 5)

CATH Domains (2, 10)

Pfam Domains (0, 0)

Gene Ontology (42, 42)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E (GCH1_HUMAN | P30793)

molecular function
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0003934	GTP cyclohydrolase I activity	Catalysis of the reaction: GTP + H2O = formate + 7,8-dihydroneopterin 3'-triphosphate.
	GO:0030742	GTP-dependent protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules) using energy from the hydrolysis of GTP.
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0050662	coenzyme binding	Interacting selectively and non-covalently with a coenzyme, any of various nonprotein organic cofactors that are required, in addition to an enzyme and a substrate, for an enzymatic reaction to proceed.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0035998	7,8-dihydroneopterin 3'-triphosphate biosynthetic process	The chemical reactions and pathways resulting in the formation of 7,8-dihydroneopterin 3'-triphosphate.
	GO:0051066	dihydrobiopterin metabolic process	The chemical reactions and pathways involving a dihydrobiopterin, a reduced pteridine derivative related to folic acid; it acts as an electron carrier in tyrosine biosynthesis and its quinoid form is produced by oxidation of tetrahydrobiopterin in several biological hydroxylation reactions.
	GO:0042416	dopamine biosynthetic process	The chemical reactions and pathways resulting in the formation of dopamine, a catecholamine neurotransmitter and a metabolic precursor of noradrenaline and adrenaline.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0045776	negative regulation of blood pressure	Any process in which the force of blood traveling through the circulatory system is decreased.
	GO:0050884	neuromuscular process controlling posture	Any process in which an organism voluntarily modulates its posture, the alignment of its anatomical parts.
	GO:0006809	nitric oxide biosynthetic process	The chemical reactions and pathways resulting in the formation of nitric oxide, nitrogen monoxide (NO), a colorless gas only slightly soluble in water.
	GO:0051000	positive regulation of nitric-oxide synthase activity	Any process that activates or increases the activity of the enzyme nitric-oxide synthase.
	GO:0006461	protein complex assembly	The aggregation, arrangement and bonding together of a set of components to form a protein complex.
	GO:0051291	protein heterooligomerization	The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers that are not all identical. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
	GO:0051260	protein homooligomerization	The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of identical component monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
	GO:0042559	pteridine-containing compound biosynthetic process	The chemical reactions and pathways resulting in the formation of any compound containing pteridine (pyrazino(2,3-dipyrimidine)), e.g. pteroic acid, xanthopterin and folic acid.
	GO:0008217	regulation of blood pressure	Any process that modulates the force with which blood travels through the circulatory system. The process is controlled by a balance of processes that increase pressure and decrease pressure.
	GO:0014916	regulation of lung blood pressure	The process that modulates the force with which blood travels through the lungs. The process is controlled by a balance of processes that increase pressure and decrease pressure.
	GO:0050999	regulation of nitric-oxide synthase activity	Any process that modulates the activity of the enzyme nitric-oxide synthase.
	GO:2000121	regulation of removal of superoxide radicals	Any process that modulates the frequency, rate or extent of removal of superoxide radicals.
	GO:0034341	response to interferon-gamma	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interferon-gamma stimulus. Interferon-gamma is also known as type II interferon.
	GO:0032496	response to lipopolysaccharide	Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0048265	response to pain	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a pain stimulus. Pain stimuli cause activation of nociceptors, peripheral receptors for pain, include receptors which are sensitive to painful mechanical stimuli, extreme heat or cold, and chemical stimuli.
	GO:0034612	response to tumor necrosis factor	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a tumor necrosis factor stimulus.
	GO:0006729	tetrahydrobiopterin biosynthetic process	The chemical reactions and pathways resulting in the formation of tetrahydrobiopterin, the reduced form of biopterin (2-amino-4-hydroxy-6-(1,2-dihydroxypropyl)-pteridine). It functions as a hydroxylation coenzyme, e.g. in the conversion of phenylalanine to tyrosine.
	GO:0046654	tetrahydrofolate biosynthetic process	The chemical reactions and pathways resulting in the formation of tetrahydrofolate, 5,6,7,8-tetrahydrofolic acid, a folate derivative bearing additional hydrogens on the pterin group.
	GO:0042311	vasodilation	An increase in the internal diameter of blood vessels, especially arterioles or capillaries, due to relaxation of smooth muscle cells that line the vessels, and usually resulting in a decrease in blood pressure.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0031410	cytoplasmic vesicle	A vesicle found in the cytoplasm of a cell.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0031965	nuclear membrane	Either of the lipid bilayers that surround the nucleus and form the nuclear envelope; excludes the intermembrane space.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 10)

Sites (10, 10)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (39, 195)

PROSITE Motifs (2, 10)

Exons (6, 30)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 5)

CATH Domains (2, 10)

Pfam Domains (0, 0)

Gene Ontology (42, 42)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File