1EY2 - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Title :   HUMAN HOMOGENTISATE DIOXYGENASE WITH FE(II)

Authors :   D. E. Timm, G. P. Titus, M. A. Penalva, H. A. Mueller, S. M. De Cordoba

Date :   05 May 00 (Deposition) - 05 Nov 00 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A
Biol. Unit 1: A  (6x)

Keywords :   Jelly Roll, Beta Sandwich, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   G. P. Titus, H. A. Mueller, J. Burgner, S. Rodriguez De Cordoba, M. A. Penalva, D. E. Timm
Crystal Structure Of Human Homogentisate Dioxygenase.
Nat. Struct. Biol. V. 7 542 2000
PubMed-ID: 10876237 | Reference-DOI: 10.1038/76756

Molecule 1 - HOMOGENTISATE 1,2-DIOXYGENASE
	Chains	:	A
	EC Number	:	1.13.11.5
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET19B
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Tissue	:	LIVER

		1
Asymmetric Unit	:	A
Biological Unit 1 (6x)	:	A

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 10)

No.	Name	Count	Type	Full Name
1	FE2	1	Ligand/Ion	FE (II) ION
2	MSE	9	Mod. Amino Acid	SELENOMETHIONINE

Biological Unit 1 (2, 60)

No.	Name	Count	Type	Full Name
1	FE2	6	Ligand/Ion	FE (II) ION
2	MSE	54	Mod. Amino Acid	SELENOMETHIONINE

Asymmetric Unit (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HIS A:335 , GLU A:341 , HIS A:371 , HOH A:2231 , HOH A:2232	BINDING SITE FOR RESIDUE FE2 A 1001

(no "SS Bond" information available for 1EY2)

(no "Cis Peptide Bond" information available for 1EY2)

Asymmetric Unit (70, 70)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_073076	E	3	A	HGD_HUMAN	Disease (AKU)	200412910	A	E	3	A
02	UniProt	VAR_073077	E	13	K	HGD_HUMAN	Disease (AKU)	---	A	E	13	K
03	UniProt	VAR_073078	D	18	N	HGD_HUMAN	Disease (AKU)	---	A	D	18	N
04	UniProt	VAR_009618	L	25	P	HGD_HUMAN	Disease (AKU)	---	A	L	25	P
05	UniProt	VAR_073079	Q	33	R	HGD_HUMAN	Disease (AKU)	---	A	Q	33	R
06	UniProt	VAR_005272	E	42	A	HGD_HUMAN	Disease (AKU)	373921680	A	E	42	A
07	UniProt	VAR_073080	L	44	F	HGD_HUMAN	Disease (AKU)	---	A	L	44	F
08	UniProt	VAR_073081	R	53	Q	HGD_HUMAN	Disease (AKU)	200808744	A	R	53	Q
09	UniProt	VAR_005273	W	60	G	HGD_HUMAN	Disease (AKU)	---	A	W	60	G
10	UniProt	VAR_073082	L	61	P	HGD_HUMAN	Disease (AKU)	---	A	L	61	P
11	UniProt	VAR_005274	Y	62	C	HGD_HUMAN	Disease (AKU)	---	A	Y	62	C
12	UniProt	VAR_073083	F	73	L	HGD_HUMAN	Disease (AKU)	---	A	F	73	L
13	UniProt	VAR_049353	Q	80	H	HGD_HUMAN	Polymorphism	2255543	A	H	80	H
14	UniProt	VAR_073084	P	92	T	HGD_HUMAN	Disease (AKU)	---	A	P	92	T
15	UniProt	VAR_005275	W	97	G	HGD_HUMAN	Disease (AKU)	---	A	W	97	G
16	UniProt	VAR_073085	W	97	R	HGD_HUMAN	Disease (AKU)	---	A	W	97	R
17	UniProt	VAR_073086	G	115	R	HGD_HUMAN	Disease (AKU)	755734596	A	G	115	R
18	UniProt	VAR_073087	L	116	P	HGD_HUMAN	Disease (AKU)	569846003	A	L	116	P
19	UniProt	VAR_073088	C	120	F	HGD_HUMAN	Disease (AKU)	752153829	A	C	120	F
20	UniProt	VAR_073089	C	120	W	HGD_HUMAN	Disease (AKU)	149165166	A	C	120	W
21	UniProt	VAR_005276	A	122	D	HGD_HUMAN	Disease (AKU)	---	A	A	122	D
22	UniProt	VAR_073090	A	122	V	HGD_HUMAN	Disease (AKU)	544956641	A	A	122	V
23	UniProt	VAR_073091	G	123	A	HGD_HUMAN	Disease (AKU)	374473331	A	G	123	A
24	UniProt	VAR_073092	G	123	R	HGD_HUMAN	Disease (AKU)	564979861	A	G	123	R
25	UniProt	VAR_073093	L	137	P	HGD_HUMAN	Disease (AKU)	---	A	L	137	P
26	UniProt	VAR_073094	G	152	A	HGD_HUMAN	Disease (AKU)	---	A	G	152	A
27	UniProt	VAR_005277	D	153	G	HGD_HUMAN	Disease (AKU)	775274569	A	D	153	G
28	UniProt	VAR_073095	P	158	L	HGD_HUMAN	Disease (AKU)	375396766	A	P	158	L
29	UniProt	VAR_005278	G	161	R	HGD_HUMAN	Disease (AKU)	28941783	A	G	161	R
30	UniProt	VAR_073096	E	168	D	HGD_HUMAN	Disease (AKU)	780173554	A	E	168	D
31	UniProt	VAR_009619	E	168	K	HGD_HUMAN	Disease (AKU)	375283568	A	E	168	K
32	UniProt	VAR_073097	F	169	L	HGD_HUMAN	Disease (AKU)	756134838	A	F	169	L
33	UniProt	VAR_073098	K	171	N	HGD_HUMAN	Disease (AKU)	---	A	K	171	N
34	UniProt	VAR_073099	M	172	T	HGD_HUMAN	Polymorphism	---	A	M	172	T
35	UniProt	VAR_073100	E	178	G	HGD_HUMAN	Disease (AKU)	---	A	E	178	G
36	UniProt	VAR_073101	Q	183	R	HGD_HUMAN	Disease (AKU)	---	A	Q	183	R
37	UniProt	VAR_073102	R	187	G	HGD_HUMAN	Disease (AKU)	---	A	R	187	G
38	UniProt	VAR_005279	S	189	I	HGD_HUMAN	Disease (AKU)	---	A	S	189	I
39	UniProt	VAR_073103	R	197	G	HGD_HUMAN	Disease (AKU)	---	A	R	197	G
40	UniProt	VAR_005280	I	216	T	HGD_HUMAN	Disease (AKU)	767201131	A	I	216	T
41	UniProt	VAR_073104	G	217	W	HGD_HUMAN	Disease (AKU)	---	A	G	217	W
42	UniProt	VAR_073105	N	219	S	HGD_HUMAN	Disease (AKU)	---	A	N	219	S
43	UniProt	VAR_005281	R	225	H	HGD_HUMAN	Disease (AKU)	562853291	A	R	225	H
44	UniProt	VAR_073106	R	225	L	HGD_HUMAN	Disease (AKU)	---	A	R	225	L
45	UniProt	VAR_073107	R	225	P	HGD_HUMAN	Disease (AKU)	562853291	A	R	225	P
46	UniProt	VAR_005282	F	227	S	HGD_HUMAN	Disease (AKU)	---	A	F	227	S
47	UniProt	VAR_005283	P	230	S	HGD_HUMAN	Disease (AKU)	28942100	A	P	230	S
48	UniProt	VAR_005284	P	230	T	HGD_HUMAN	Disease (AKU)	---	A	P	230	T
49	UniProt	VAR_073108	V	245	F	HGD_HUMAN	Disease (AKU)	---	A	V	245	F
50	UniProt	VAR_073109	Q	258	P	HGD_HUMAN	Disease (AKU)	759843592	A	Q	258	P
51	UniProt	VAR_073110	H	269	R	HGD_HUMAN	Disease (AKU)	756522409	A	H	269	R
52	UniProt	VAR_009620	G	270	R	HGD_HUMAN	Disease (AKU)	120074174	A	G	270	R
53	UniProt	VAR_073111	K	276	N	HGD_HUMAN	Disease (AKU)	---	A	K	276	N
54	UniProt	VAR_005285	D	291	E	HGD_HUMAN	Disease (AKU)	754428438	A	D	291	E
55	UniProt	VAR_005286	V	300	G	HGD_HUMAN	Disease (AKU)	120074170	A	V	300	G
56	UniProt	VAR_073112	R	321	P	HGD_HUMAN	Disease (AKU)	---	A	R	321	P
57	UniProt	VAR_073113	F	329	C	HGD_HUMAN	Disease (AKU)	---	A	F	329	C
58	UniProt	VAR_008744	R	330	S	HGD_HUMAN	Disease (AKU)	120074171	A	R	330	S
59	UniProt	VAR_073114	N	337	D	HGD_HUMAN	Disease (AKU)	---	A	N	337	D
60	UniProt	VAR_073115	P	359	L	HGD_HUMAN	Disease (AKU)	764037565	A	P	359	L
61	UniProt	VAR_073116	G	360	A	HGD_HUMAN	Disease (AKU)	---	A	G	360	A
62	UniProt	VAR_073117	G	360	R	HGD_HUMAN	Disease (AKU)	368717991	A	G	360	R
63	UniProt	VAR_073118	G	361	R	HGD_HUMAN	Disease (AKU)	765219004	A	G	361	R
64	UniProt	VAR_073119	G	362	E	HGD_HUMAN	Disease (AKU)	---	A	G	362	E
65	UniProt	VAR_005287	M	368	V	HGD_HUMAN	Disease (AKU)	120074173	A	M	368	V
66	UniProt	VAR_073120	T	369	N	HGD_HUMAN	Disease (AKU)	765912447	A	T	369	N
67	UniProt	VAR_008745	H	371	R	HGD_HUMAN	Disease (AKU)	120074172	A	H	371	R
68	UniProt	VAR_073121	P	373	L	HGD_HUMAN	Disease (AKU)	138558042	A	P	373	L
69	UniProt	VAR_073122	D	374	H	HGD_HUMAN	Disease (AKU)	---	A	D	374	H
70	UniProt	VAR_073123	E	401	Q	HGD_HUMAN	Disease (AKU)	767159114	A	E	401	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (70, 420)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_073076	E	3	A	HGD_HUMAN	Disease (AKU)	200412910	A	E	3	A
02	UniProt	VAR_073077	E	13	K	HGD_HUMAN	Disease (AKU)	---	A	E	13	K
03	UniProt	VAR_073078	D	18	N	HGD_HUMAN	Disease (AKU)	---	A	D	18	N
04	UniProt	VAR_009618	L	25	P	HGD_HUMAN	Disease (AKU)	---	A	L	25	P
05	UniProt	VAR_073079	Q	33	R	HGD_HUMAN	Disease (AKU)	---	A	Q	33	R
06	UniProt	VAR_005272	E	42	A	HGD_HUMAN	Disease (AKU)	373921680	A	E	42	A
07	UniProt	VAR_073080	L	44	F	HGD_HUMAN	Disease (AKU)	---	A	L	44	F
08	UniProt	VAR_073081	R	53	Q	HGD_HUMAN	Disease (AKU)	200808744	A	R	53	Q
09	UniProt	VAR_005273	W	60	G	HGD_HUMAN	Disease (AKU)	---	A	W	60	G
10	UniProt	VAR_073082	L	61	P	HGD_HUMAN	Disease (AKU)	---	A	L	61	P
11	UniProt	VAR_005274	Y	62	C	HGD_HUMAN	Disease (AKU)	---	A	Y	62	C
12	UniProt	VAR_073083	F	73	L	HGD_HUMAN	Disease (AKU)	---	A	F	73	L
13	UniProt	VAR_049353	Q	80	H	HGD_HUMAN	Polymorphism	2255543	A	H	80	H
14	UniProt	VAR_073084	P	92	T	HGD_HUMAN	Disease (AKU)	---	A	P	92	T
15	UniProt	VAR_005275	W	97	G	HGD_HUMAN	Disease (AKU)	---	A	W	97	G
16	UniProt	VAR_073085	W	97	R	HGD_HUMAN	Disease (AKU)	---	A	W	97	R
17	UniProt	VAR_073086	G	115	R	HGD_HUMAN	Disease (AKU)	755734596	A	G	115	R
18	UniProt	VAR_073087	L	116	P	HGD_HUMAN	Disease (AKU)	569846003	A	L	116	P
19	UniProt	VAR_073088	C	120	F	HGD_HUMAN	Disease (AKU)	752153829	A	C	120	F
20	UniProt	VAR_073089	C	120	W	HGD_HUMAN	Disease (AKU)	149165166	A	C	120	W
21	UniProt	VAR_005276	A	122	D	HGD_HUMAN	Disease (AKU)	---	A	A	122	D
22	UniProt	VAR_073090	A	122	V	HGD_HUMAN	Disease (AKU)	544956641	A	A	122	V
23	UniProt	VAR_073091	G	123	A	HGD_HUMAN	Disease (AKU)	374473331	A	G	123	A
24	UniProt	VAR_073092	G	123	R	HGD_HUMAN	Disease (AKU)	564979861	A	G	123	R
25	UniProt	VAR_073093	L	137	P	HGD_HUMAN	Disease (AKU)	---	A	L	137	P
26	UniProt	VAR_073094	G	152	A	HGD_HUMAN	Disease (AKU)	---	A	G	152	A
27	UniProt	VAR_005277	D	153	G	HGD_HUMAN	Disease (AKU)	775274569	A	D	153	G
28	UniProt	VAR_073095	P	158	L	HGD_HUMAN	Disease (AKU)	375396766	A	P	158	L
29	UniProt	VAR_005278	G	161	R	HGD_HUMAN	Disease (AKU)	28941783	A	G	161	R
30	UniProt	VAR_073096	E	168	D	HGD_HUMAN	Disease (AKU)	780173554	A	E	168	D
31	UniProt	VAR_009619	E	168	K	HGD_HUMAN	Disease (AKU)	375283568	A	E	168	K
32	UniProt	VAR_073097	F	169	L	HGD_HUMAN	Disease (AKU)	756134838	A	F	169	L
33	UniProt	VAR_073098	K	171	N	HGD_HUMAN	Disease (AKU)	---	A	K	171	N
34	UniProt	VAR_073099	M	172	T	HGD_HUMAN	Polymorphism	---	A	M	172	T
35	UniProt	VAR_073100	E	178	G	HGD_HUMAN	Disease (AKU)	---	A	E	178	G
36	UniProt	VAR_073101	Q	183	R	HGD_HUMAN	Disease (AKU)	---	A	Q	183	R
37	UniProt	VAR_073102	R	187	G	HGD_HUMAN	Disease (AKU)	---	A	R	187	G
38	UniProt	VAR_005279	S	189	I	HGD_HUMAN	Disease (AKU)	---	A	S	189	I
39	UniProt	VAR_073103	R	197	G	HGD_HUMAN	Disease (AKU)	---	A	R	197	G
40	UniProt	VAR_005280	I	216	T	HGD_HUMAN	Disease (AKU)	767201131	A	I	216	T
41	UniProt	VAR_073104	G	217	W	HGD_HUMAN	Disease (AKU)	---	A	G	217	W
42	UniProt	VAR_073105	N	219	S	HGD_HUMAN	Disease (AKU)	---	A	N	219	S
43	UniProt	VAR_005281	R	225	H	HGD_HUMAN	Disease (AKU)	562853291	A	R	225	H
44	UniProt	VAR_073106	R	225	L	HGD_HUMAN	Disease (AKU)	---	A	R	225	L
45	UniProt	VAR_073107	R	225	P	HGD_HUMAN	Disease (AKU)	562853291	A	R	225	P
46	UniProt	VAR_005282	F	227	S	HGD_HUMAN	Disease (AKU)	---	A	F	227	S
47	UniProt	VAR_005283	P	230	S	HGD_HUMAN	Disease (AKU)	28942100	A	P	230	S
48	UniProt	VAR_005284	P	230	T	HGD_HUMAN	Disease (AKU)	---	A	P	230	T
49	UniProt	VAR_073108	V	245	F	HGD_HUMAN	Disease (AKU)	---	A	V	245	F
50	UniProt	VAR_073109	Q	258	P	HGD_HUMAN	Disease (AKU)	759843592	A	Q	258	P
51	UniProt	VAR_073110	H	269	R	HGD_HUMAN	Disease (AKU)	756522409	A	H	269	R
52	UniProt	VAR_009620	G	270	R	HGD_HUMAN	Disease (AKU)	120074174	A	G	270	R
53	UniProt	VAR_073111	K	276	N	HGD_HUMAN	Disease (AKU)	---	A	K	276	N
54	UniProt	VAR_005285	D	291	E	HGD_HUMAN	Disease (AKU)	754428438	A	D	291	E
55	UniProt	VAR_005286	V	300	G	HGD_HUMAN	Disease (AKU)	120074170	A	V	300	G
56	UniProt	VAR_073112	R	321	P	HGD_HUMAN	Disease (AKU)	---	A	R	321	P
57	UniProt	VAR_073113	F	329	C	HGD_HUMAN	Disease (AKU)	---	A	F	329	C
58	UniProt	VAR_008744	R	330	S	HGD_HUMAN	Disease (AKU)	120074171	A	R	330	S
59	UniProt	VAR_073114	N	337	D	HGD_HUMAN	Disease (AKU)	---	A	N	337	D
60	UniProt	VAR_073115	P	359	L	HGD_HUMAN	Disease (AKU)	764037565	A	P	359	L
61	UniProt	VAR_073116	G	360	A	HGD_HUMAN	Disease (AKU)	---	A	G	360	A
62	UniProt	VAR_073117	G	360	R	HGD_HUMAN	Disease (AKU)	368717991	A	G	360	R
63	UniProt	VAR_073118	G	361	R	HGD_HUMAN	Disease (AKU)	765219004	A	G	361	R
64	UniProt	VAR_073119	G	362	E	HGD_HUMAN	Disease (AKU)	---	A	G	362	E
65	UniProt	VAR_005287	M	368	V	HGD_HUMAN	Disease (AKU)	120074173	A	M	368	V
66	UniProt	VAR_073120	T	369	N	HGD_HUMAN	Disease (AKU)	765912447	A	T	369	N
67	UniProt	VAR_008745	H	371	R	HGD_HUMAN	Disease (AKU)	120074172	A	H	371	R
68	UniProt	VAR_073121	P	373	L	HGD_HUMAN	Disease (AKU)	138558042	A	P	373	L
69	UniProt	VAR_073122	D	374	H	HGD_HUMAN	Disease (AKU)	---	A	D	374	H
70	UniProt	VAR_073123	E	401	Q	HGD_HUMAN	Disease (AKU)	767159114	A	E	401	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 1EY2)

Asymmetric Unit (14, 14)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000283871	1a	ENSE00001950843	chr3:120401418-120400944	475	HGD_HUMAN	1-5	5	1	A:2-5	4
1.3	ENST00000283871	3	ENSE00001737886	chr3:120394710-120394639	72	HGD_HUMAN	6-29	24	1	A:6-29	24
1.4a	ENST00000283871	4a	ENSE00001774025	chr3:120393836-120393748	89	HGD_HUMAN	30-59	30	1	A:30-59	30
1.5a	ENST00000283871	5a	ENSE00001725712	chr3:120389379-120389274	106	HGD_HUMAN	59-94	36	1	A:59-94	36
1.6a	ENST00000283871	6a	ENSE00001658207	chr3:120371498-120371439	60	HGD_HUMAN	95-114	20	1	A:95-114	20
1.7b	ENST00000283871	7b	ENSE00001740085	chr3:120369712-120369621	92	HGD_HUMAN	115-145	31	1	A:115-145	31
1.8	ENST00000283871	8	ENSE00001686509	chr3:120366758-120366724	35	HGD_HUMAN	145-157	13	1	A:145-157	13
1.9b	ENST00000283871	9b	ENSE00001596862	chr3:120365899-120365820	80	HGD_HUMAN	157-183	27	1	A:157-183	27
1.10a	ENST00000283871	10a	ENSE00002142393	chr3:120365213-120365114	100	HGD_HUMAN	184-217	34	1	A:184-217	34
1.12	ENST00000283871	12	ENSE00001751280	chr3:120363290-120363166	125	HGD_HUMAN	217-258	42	1	A:217-258	42
1.13b	ENST00000283871	13b	ENSE00001733639	chr3:120360540-120360436	105	HGD_HUMAN	259-293	35	1	A:259-293	35
1.14b	ENST00000283871	14b	ENSE00001753143	chr3:120357428-120357302	127	HGD_HUMAN	294-336	43	1	A:294-336	43
1.16a	ENST00000283871	16a	ENSE00001681668	chr3:120352175-120351994	182	HGD_HUMAN	336-396	61	1	A:336-396 (gaps)	61
1.17b	ENST00000283871	17b	ENSE00001743017	chr3:120347376-120347020	357	HGD_HUMAN	397-445	49	1	A:397-440 (gaps)	44

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:419
 aligned with HGD_HUMAN | Q93099 from UniProtKB/Swiss-Prot  Length:445

    Alignment length:439
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431         
            HGD_HUMAN     2 AELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGQVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHYEAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRN 440
               SCOP domains d1ey2a_ A: Homogentisate dioxygenase                                                                                                                                                                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee.....eeee.................hhhhheeeeee......hhhhh.eeeeee..........ee...................eee..................eeeeeeeee....eeeeeeeeee......eeeee..eeeeeeeee..eeeee..eeeee...eeeee.....eeee....eeeeeeeee........hhhhh.....hhh.eeee.......eeeeeeeeeeee..eeeeeeeee....eeeeee....eeee.hhh...........hhhh.eeeeee......eeeeeeee..eee................eeeeeeee--------......eeee........hhhhhhhhhhh....eee....eeeeeee....eehhhhhhhh.------------........... Sec.struct. author
             SAPs(SNPs) (1) -A---------K----N------P-------R--------A-F--------Q------GPC----------L------H-----------T----G-----------------RP---F-DA-------------P--------------AG----L--R------DL-NT-----G----R---G-I-------G------------------TW-S-----H-S--S--------------F------------P----------RR-----N--------------E--------G--------------------P-------CS------D---------------------LARE-----VN-R-LH--------------------------Q--------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------R----------------------W-VR--------------------------------------------K--------------------------------------------------------L----T---------------------------------------------------------------------------------------------------------------------------------R-------------------------------------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------P----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.1aExon 1.3  PDB: A:6-29   Exon 1.4a  PDB: A:30-59       -----------------------------------Exon 1.6a           Exon 1.7b  PDB: A:115-145      -----------Exon 1.9b  PDB: A:157-183  Exon 1.10a  PDB: A:184-217        -----------------------------------------Exon 1.13b  PDB: A:259-293         Exon 1.14b  PDB: A:294-336 UniProt: 294-336------------------------------------------------------------Exon 1.17b  PDB: A:397-440 (gaps)            Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------Exon 1.5a  PDB: A:59-94             --------------------------------------------------Exon 1.8     -----------------------------------------------------------Exon 1.12  PDB: A:217-258 UniProt: 217-258-----------------------------------------------------------------------------Exon 1.16a  PDB: A:336-396 (gaps) UniProt: 336-396           -------------------------------------------- Transcript 1 (2)
                 1ey2 A   2 AELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSmENRCFYNSDGDFLIVPQKGNLLIYTEFGKmLVQPNEICVIQRGmRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFmVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCmSEFmGLIR--------GFLPGGGSLHSTmTPHGPDADCFEKASKVKLAPERIADGTmAFmFESSLSLAVTKWGLKASR------------LKSHFTPNSRN 440
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141|      151       161       171|      181    |  191       201       211       221       231       241       251       261       271       281 |     291       301       311       321       331       341 |   |   -    |  361      |371       381       391    |  401       411     |   -       431         
                                                                                                                                                                      142-MSE                       172-MSE       186-MSE                                                                                          283-MSE                                                 339-MSE 347      356         368-MSE                     396-MSE              417          430          
                                                                                                                                                                                                                                                                                                                                                                               343-MSE                                                 399-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Double-stranded beta-helix (580)

Superfamily: RmlC-like cupins (220)

Family: Homogentisate dioxygenase (2)

Protein domain: Homogentisate dioxygenase (2)

Human (Homo sapiens) [TaxId: 9606] (2)

d1ey2a_

(no "CATH Domain" information available for 1EY2)

(no "Pfam Domain" information available for 1EY2)

Asymmetric Unit(hide GO term definitions)

Chain A (HGD_HUMAN | Q93099)

molecular function
	GO:0051213	dioxygenase activity	Catalysis of an oxidation-reduction (redox) reaction in which both atoms of oxygen from one molecule of O2 are incorporated into the (reduced) product(s) of the reaction. The two atoms of oxygen may be distributed between two different products.
	GO:0004411	homogentisate 1,2-dioxygenase activity	Catalysis of the reaction: homogentisate + O(2) = 4-maleylacetoacetate + H(+).
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006559	L-phenylalanine catabolic process	The chemical reactions and pathways resulting in the breakdown of phenylalanine, 2-amino-3-phenylpropanoic acid.
	GO:0006520	cellular amino acid metabolic process	The chemical reactions and pathways involving amino acids, carboxylic acids containing one or more amino groups, as carried out by individual cells.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006572	tyrosine catabolic process	The chemical reactions and pathways resulting in the breakdown of tyrosine, an aromatic amino acid, 2-amino-3-(4-hydroxyphenyl)propanoic acid.
	GO:0006570	tyrosine metabolic process	The chemical reactions and pathways involving tyrosine, an aromatic amino acid, 2-amino-3-(4-hydroxyphenyl)propanoic acid.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		FE2	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ey2)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1ey2
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	HGD_HUMAN \| Q93099
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.13.11.5
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	203500
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	HGD_HUMAN \| Q93099
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	HGD_HUMAN \| Q93099	:	1eyb

1eyb	1EYB CONTAINS THE APO FORM OF THE SAME PROTEIN.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 10)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (70, 70)

PROSITE Motifs (0, 0)

Exons (14, 14)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (12, 12)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File