Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF BACTERIOCIN AS-48
 
Authors :  C. Gonzalez, G. Langdon, M. Bruix, A. Galvez, E. Valdivia, M. Maqueda, M
Date :  09 Aug 00  (Deposition) - 25 Oct 00  (Release) - 03 Aug 11  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Antibiotic, Bacteriocins, Cationic Antibacterial Peptides, Five-Helix Globule, Cyclic Polypeptide (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Gonzalez, G. Langdon, M. Bruix, A. Galvez, E. Valdivia, M. Maqueda, M. Rico
Bacteriocin As-48, A Microbial Cyclic Polypeptide Structurally And Functionally Related To Mammalian Nk-Lysin
Proc. Natl. Acad. Sci. Usa V. 97 11221 2000
PubMed-ID: 11005847  |  Reference-DOI: 10.1073/PNAS.210301097
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - AS-48 PROTEIN
    Chains: A
    Fragment: BACTERIOCIN AS-48, RESIDUES 36-105
    Organism Scientific: ENTEROCOCCUS FAECALIS
    Organism Taxid: 1351
    Other Details: PEPTIDE LINK BETWEEN RESIDUES 1 AND 70
    Plasmid: PMB2
    Synonym: BACTERIOCIN AS-4, PEPTIDE ANTIBIOTIC AS-48

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1E68)

(-) Sites  (0, 0)

(no "Site" information available for 1E68)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1E68)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1E68)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1E68)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1E68)

(-) Exons   (0, 0)

(no "Exon" information available for 1E68)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:70
 aligned with Q47765_ENTFL | Q47765 from UniProtKB/TrEMBL  Length:105

    Alignment length:70
                                    45        55        65        75        85        95       105
         Q47765_ENTFL    36 MAKEFGIPAAVAGTVLNVVEAGGWVTTIVSILTAVGSGGLSLLAAAGRESIKAYLKKEIKKKGKRAVIAW 105
               SCOP domains d1e68a_ A: Bacteriocin AS-48                                           SCOP domains
               CATH domains 1e68A00 A:1-70 Bacteriocin As-48; Chain A                              CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh...hhhhhhhhhhhhh...hhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhh.hhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                 1e68 A   1 MAKEFGIPAAVAGTVLNVVEAGGWVTTIVSILTAVGSGGLSLLAAAGRESIKAYLKKEIKKKGKRAVIAW  70
                                    10        20        30        40        50        60        70
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1E68)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (Q47765_ENTFL | Q47765)
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1e68)
 
  Sites
(no "Sites" information available for 1e68)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1e68)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1e68
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q47765_ENTFL | Q47765
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q47765_ENTFL | Q47765
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q47765_ENTFL | Q47765: 1o82 1o83 1o84 4rgd

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1E68)