|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (4, 8) Biological Unit 1 (4, 16) |
Asymmetric Unit (8, 8)
|
(no "SS Bond" information available for 1O84) |
(no "Cis Peptide Bond" information available for 1O84) |
(no "SAP(SNP)/Variant" information available for 1O84) |
(no "PROSITE Motif" information available for 1O84) |
(no "Exon" information available for 1O84) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:70 aligned with Q47765_ENTFL | Q47765 from UniProtKB/TrEMBL Length:105 Alignment length:70 45 55 65 75 85 95 105 Q47765_ENTFL 36 MAKEFGIPAAVAGTVLNVVEAGGWVTTIVSILTAVGSGGLSLLAAAGRESIKAYLKKEIKKKGKRAVIAW 105 SCOP domains d1o84a_ A: Bacteriocin AS-48 SCOP domains CATH domains 1o84A00 A:1-70 Bacteriocin As-48; Chain A CATH domains Pfam domains ---------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------- Transcript 1o84 A 1 MAKEFGIPAAVAGTVLNVVEAGGWVTTIVSILTAVGSGGLSLLAAAGRESIKAYLKKEIKKKGKRAVIAW 70 10 20 30 40 50 60 70 Chain B from PDB Type:PROTEIN Length:70 aligned with Q47765_ENTFL | Q47765 from UniProtKB/TrEMBL Length:105 Alignment length:70 45 55 65 75 85 95 105 Q47765_ENTFL 36 MAKEFGIPAAVAGTVLNVVEAGGWVTTIVSILTAVGSGGLSLLAAAGRESIKAYLKKEIKKKGKRAVIAW 105 SCOP domains d1o84b_ B: Bacteriocin AS-48 SCOP domains CATH domains 1o84B00 B:1-70 Bacteriocin As-48; Chain A CATH domains Pfam domains ---------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------- Transcript 1o84 B 1 MAKEFGIPAAVAGTVLNVVEAGGWVTTIVSILTAVGSGGLSLLAAAGRESIKAYLKKEIKKKGKRAVIAW 70 10 20 30 40 50 60 70
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 1O84) |
Asymmetric Unit(hide GO term definitions) Chain A,B (Q47765_ENTFL | Q47765)
|
|
|
|
|
|
|