|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1E09) |
Sites (0, 0)| (no "Site" information available for 1E09) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1E09) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1E09) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1E09) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1E09) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:159 aligned with PRU1_PRUAV | O24248 from UniProtKB/Swiss-Prot Length:160 Alignment length:159 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 PRU1_PRUAV 2 GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSHYHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160 SCOP domains d1e09a_ A: Major tree pollen allergen SCOP domains CATH domains 1e09A00 A:1-159 [code=3.30.530.20, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------PATHOGENESIS_BETVI PDB: A:88-120--------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1e09 A 1 GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSHYHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 159 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1E09) |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (PRU1_PRUAV | O24248)
|
||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|