|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (4, 4)
NMR Structure (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1DAQ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1DAQ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1DAQ) |
PROSITE Motifs (2, 3)
NMR Structure (2, 3)
|
||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1DAQ) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:71 aligned with GUNS_CLOTH | A3DH67 from UniProtKB/Swiss-Prot Length:741 Alignment length:89 741 663 673 683 693 703 713 723 733 | GUNS_CLOTH 654 MGVLATYFPDMTYKVPGTPSTKLYGDVNDDGKVNSTDAVALKRYVLRSGISINTDNADLNEDGRVNSTDLGILKRYILKEIDTLPYKN- - SCOP domains d 1daqa_ A: Cellulosome endoglucanase SS SCOP domains CATH domains 1 daqA00 A:1-71 Type 1 dockerin domain CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains Chain A from PDB Type:PROTEIN Length:71 aligned with GUNS_CLOTM | P0C2S5 from UniProtKB/Swiss-Prot Length:741 Alignment length:89 741 663 673 683 693 703 713 723 733 | GUNS_CLOTM 654 MGVLATYFPDMTYKVPGTPSTKLYGDVNDDGKVNSTDAVALKRYVLRSGISINTDNADLNEDGRVNSTDLGILKRYILKEIDTLPYKN- - SCOP domains d 1daqa_ A: Cellulosome endoglucanase SS SCOP domains CATH domains 1 daqA00 A:1-71 Type 1 dockerin domain CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1DAQ) |
Gene Ontology (11, 22)|
NMR Structure(hide GO term definitions) Chain A (GUNS_CLOTH | A3DH67)
Chain A (GUNS_CLOTM | P0C2S5)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|