1D7Q - JenaLib

Title :   HUMAN TRANSLATION INITIATION FACTOR EIF1A

Authors :   J. L. Battiste, T. V. Pestova, C. U. T. Hellen, G. Wagner

Date :   19 Oct 99 (Deposition) - 17 Mar 00 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A,B  (20x)

Keywords :   Ob-Fold, Beta-Barrel, Rna-Binding Protein, Gene Regulation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. L. Battiste, T. V. Pestova, C. U. Hellen, G. Wagner
The Eif1A Solution Structure Reveals A Large Rna-Binding Surface Important For Scanning Function.
Mol. Cell V. 5 109 2000
PubMed-ID: 10678173 | Reference-DOI: 10.1016/S1097-2765(00)80407-4
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 2)

Exons (7, 7)

NMR Structure (7, 7)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000379607	1a	ENSE00001481854	X:20159962-20159743	220	IF1AX_HUMAN	1-6	6	1	A:15-19	5
1.2	ENST00000379607	2	ENSE00001689602	X:20156740-20156657	84	IF1AX_HUMAN	6-34	29	1	A:19-47	29
1.3	ENST00000379607	3	ENSE00001742922	X:20153959-20153856	104	IF1AX_HUMAN	34-68	35	1	A:47-81	35
1.4	ENST00000379607	4	ENSE00001801842	X:20152125-20152075	51	IF1AX_HUMAN	69-85	17	1	A:82-98	17
1.5	ENST00000379607	5	ENSE00001733715	X:20150381-20150300	82	IF1AX_HUMAN	86-113	28	1	A:99-126	28
1.6	ENST00000379607	6	ENSE00001199818	X:20148725-20148634	92	IF1AX_HUMAN	113-143	31	1	A:126-156	31
1.7b	ENST00000379607	7b	ENSE00001326974	X:20146429-20142636	3794	IF1AX_HUMAN	144-144	1	1	A:157-157	1

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:143
 aligned with IF1AX_HUMAN | P47813 from UniProtKB/Swiss-Prot  Length:144

    Alignment length:143
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141   
          IF1AX_HUMAN     2 PKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI 144
               SCOP domains d1d7qa_ A: Translation initiation factor-1a, eIF1a                                                                                              SCOP domains
               CATH domains 1d7qA00 A:15-157 Nucleic acid-binding proteins                                                                                                  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............................eeeeeeeee....eeeeee...eeeeee..hhhhhh.......eeeee.........eeeeee...hhhhhhhhh..................................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------------S1_IF1_TYPE  PDB: A:35-109 UniProt: 22-96                                  ------------------------------------------------ PROSITE (1)
                PROSITE (2) ---------------------------------------IF1A  PDB: A:54-76     --------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) 1.1a ---------------------------Exon 1.3  PDB: A:47-81             Exon 1.4         Exon 1.5  PDB: A:99-126     ------------------------------1 Transcript 1 (1)
           Transcript 1 (2) ----Exon 1.2  PDB: A:19-47       ------------------------------------------------------------------------------Exon 1.6  PDB: A:126-156       - Transcript 1 (2)
                 1d7q A  15 PKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI 157
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154

Chain B from PDB  Type:PROTEIN  Length:14
                                              
               SCOP domains -------------- SCOP domains
               CATH domains -------------- CATH domains
               Pfam domains -------------- Pfam domains
         Sec.struct. author .............. Sec.struct. author
                 SAPs(SNPs) -------------- SAPs(SNPs)
                    PROSITE -------------- PROSITE
                 Transcript -------------- Transcript
                 1d7q B   1 MRGSHHHHHHTDPM  14
                                    10

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (7, 7)

NMR Structure(hide GO term definitions)

Chain A (IF1AX_HUMAN | P47813)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008135	translation factor activity, RNA binding	Functions during translation by interacting selectively and non-covalently with RNA during polypeptide synthesis at the ribosome.
	GO:0003743	translation initiation factor activity	Functions in the initiation of ribosome-mediated translation of mRNA into a polypeptide.
biological process
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
	GO:0006413	translational initiation	The process preceding formation of the peptide bond between the first two amino acids of a protein. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1d7q)

	Sites
(no "Sites" information available for 1d7q)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1d7q)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1d7q
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	IF1AX_HUMAN \| P47813
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description