Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CITROBACTER FREUNDII RESTRICTION ENDONUCLEASE CFR10I AT 2.15 ANGSTROMS RESOLUTION.
 
Authors :  D. Bozic, S. Grazulis, V. Siksnys, R. Huber
Date :  02 Feb 96  (Deposition) - 27 Jan 97  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.15
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (4x)
Keywords :  Restriction Endonuclease, Restriction Enzyme (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Bozic, S. Grazulis, V. Siksnys, R. Huber
Crystal Structure Of Citrobacter Freundii Restriction Endonuclease Cfr10I At 2. 15 A Resolution.
J. Mol. Biol. V. 255 176 1996
PubMed-ID: 8568865  |  Reference-DOI: 10.1006/JMBI.1996.0015

(-) Compounds

Molecule 1 - RESTRICTION ENDONUCLEASE
    Chains: A
    EC Number: 3.1.21.4
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PBR327
    Expression System Strain: RR1
    Expression System Taxid: 562
    Fragment: RESIDUES 1 - 283
    Organism Scientific: CITROBACTER FREUNDII
    Organism Taxid: 546
    Other Details: CHARACTERIZATION OF CFR10I RESTRICTION ENDONUCLEASE, JANULAITIS ET AL. (1983)
    Strain: RFL10I
    Synonym: CFR10I

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (4x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1CFR)

(-) Sites  (0, 0)

(no "Site" information available for 1CFR)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1CFR)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1CFR)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1CFR)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1CFR)

(-) Exons   (0, 0)

(no "Exon" information available for 1CFR)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:283
 aligned with T2CX_CITFR | P56200 from UniProtKB/Swiss-Prot  Length:285

    Alignment length:283
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280   
           T2CX_CITFR     1 MDIISKSGEGNKYTINSAIAFVAYASHIDINTTEFSKVLSGLRDFINDEAIRLGGKISDGSFNKCNGDWYEWLIGIRAIEFFLESETNFIVVKMPNATSFDVMSIYKSCLSEFIYDLRSKLSLNNVNLITSNPDFSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNFIDYAELEHIKSFLSVKTTFRPDRRLQLAHEGSLMKALYTHLQTRTWTINPTGIRYYAAATSIGNADVIGLKTVATHSITDVKSLPQSAVDEIFKINSVLDVDSCLSHIL 283
               SCOP domains d1cfra_ A: Restriction endonuclease Cfr10I                                                                                                                                                                                                                                                  SCOP domains
               CATH domains 1cfrA00 A:1-283  [code=3.40.91.10, no name defined]                                                                                                                                                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee......eee.hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh....eeeee........hhhh..hhhhhhhhhhhhhhhhh..........eeeee....hhhhhhh..........hhhhhhhhhhhhhh........eeeeeeee....hhhhhhhhhhhhhhhhhhhhhhhh.........eeeeee....hhhhhhh....hhhh............eeee...hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1cfr A   1 MDIISKSGEGNKYTINSAIAFVAYASHIDINTTEFSKVLSGLRDFINDEAIRLGGKISDGSFNKCNGDWYEWLIGIRAIEFFLESETNFIVVKMPNATSFDVMSIYKSCLSEFIYDLRSKLSLNNVNLITSNPDFSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNFIDYAELEHIKSFLSVKTTFRPDRRLQLAHEGSLMKALYTHLQTRTWTINPTGIRYYAAATSIGNADVIGLKTVATHSITDVKSLPQSAVDEIFKINSVLDVDSCLSHIL 283
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1CFR)

(-) Gene Ontology  (8, 8)

Asymmetric Unit(hide GO term definitions)
Chain A   (T2CX_CITFR | P56200)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0009036    Type II site-specific deoxyribonuclease activity    Catalysis of the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates and 3' hydroxyls. Cleavage is dependent on the presence in the DNA of a specific recognition site; cleavage occurs at or very near this recognition site.
    GO:0004519    endonuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids by creating internal breaks.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004518    nuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids.
biological process
    GO:0009307    DNA restriction-modification system    A defense process found in many bacteria and archaea that protects the organism from invading foreign DNA by cleaving it with a restriction endonuclease. The organism's own DNA is protected by methylation of a specific nucleotide, which occurs immediately following replication, in the same target site as the restriction enzyme.
    GO:0090305    nucleic acid phosphodiester bond hydrolysis    The nucleic acid metabolic process in which the phosphodiester bonds between nucleotides are cleaved by hydrolysis.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1cfr)
 
  Sites
(no "Sites" information available for 1cfr)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1cfr)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1cfr
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  T2CX_CITFR | P56200
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.21.4
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  T2CX_CITFR | P56200
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1CFR)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1CFR)