Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  ANNEXIN IV
 
Authors :  G. Zanotti, G. Malpeli, F. Gliubich, C. Folli, M. Stoppini, L. Olivi, A. Savoia, R. Berni
Date :  11 Jul 97  (Deposition) - 14 Jan 98  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym./Biol. Unit :  A
Keywords :  Calcium/Phospholipid-Binding Protein, 32. 5Kd Calelectrin, Endonexin I, Lipocortin Iv, Chromobindin Iv, Protein Ii (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. Zanotti, G. Malpeli, F. Gliubich, C. Folli, M. Stoppini, L. Olivi, A. Savoia, R. Berni
Structure Of The Trigonal Crystal Form Of Bovine Annexin Iv.
Biochem. J. V. 329 101 1998
PubMed-ID: 9405281
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ANNEXIN IV
    ChainsA
    OrganKIDNEY
    Organism CommonCATTLE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    Synonym32.5 KD CALELECTRIN, ENDONEXIN I

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1AOW)

(-) Sites  (0, 0)

(no "Site" information available for 1AOW)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1AOW)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1AOW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1AOW)

(-) PROSITE Motifs  (1, 4)

Asymmetric/Biological Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ANNEXINPS00223 Annexins repeated domain signature.ANXA4_BOVIN31-83
103-155
187-239
262-314
  4A:30-82
A:102-154
A:186-238
A:261-313

(-) Exons   (11, 11)

Asymmetric/Biological Unit (11, 11)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSBTAT000000014631ENSBTAE00000263146chr11:70037752-7003780251ANXA4_BOVIN-00--
1.2ENSBTAT000000014632ENSBTAE00000396308chr11:70067098-7006714952ANXA4_BOVIN1-110--
1.3ENSBTAT000000014633ENSBTAE00000392060chr11:70080212-7008029988ANXA4_BOVIN2-31301A:10-3021
1.4ENSBTAT000000014634ENSBTAE00000011722chr11:70085722-7008581695ANXA4_BOVIN31-62321A:30-6132
1.8ENSBTAT000000014638ENSBTAE00000011723chr11:70088905-70089018114ANXA4_BOVIN63-100381A:62-9938
1.10ENSBTAT0000000146310ENSBTAE00000422389chr11:70089849-7008993991ANXA4_BOVIN101-131311A:100-13031
1.11ENSBTAT0000000146311ENSBTAE00000413811chr11:70091270-7009134980ANXA4_BOVIN131-157271A:130-15627
1.12ENSBTAT0000000146312ENSBTAE00000378694chr11:70093470-7009352657ANXA4_BOVIN158-176191A:157-17519
1.13ENSBTAT0000000146313ENSBTAE00000410867chr11:70101451-7010154494ANXA4_BOVIN177-208321A:176-20732
1.14ENSBTAT0000000146314ENSBTAE00000384570chr11:70107309-7010740496ANXA4_BOVIN208-240331A:207-23933
1.15ENSBTAT0000000146315ENSBTAE00000422047chr11:70107993-7010805159ANXA4_BOVIN240-259201A:239-25820
1.16ENSBTAT0000000146316ENSBTAE00000396304chr11:70109006-70109128123ANXA4_BOVIN260-300411A:259-29941
1.17ENSBTAT0000000146317ENSBTAE00000414557chr11:70112678-701137461069ANXA4_BOVIN301-319191A:300-31819

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:309
 aligned with ANXA4_BOVIN | P13214 from UniProtKB/Swiss-Prot  Length:319

    Alignment length:309
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310         
          ANXA4_BOVIN    11 ASGFNAAEDAQTLRKAMKGLGTDEDAIINVLAYRSTAQRQEIRTAYKTTIGRDLMDDLKSELSGNFEQVILGMMTPTVLYDVQELRKAMKGAGTDEGCLIEILASRTPEEIRRINQTYQLQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDESNYLDDALMRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRIAQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAERLYKSMKGLGTDDDTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSFIKGDTSGDYRKVLLILCGGDD 319
               SCOP domains d1aowa_ A: Annexin IV                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains --1aowA01 A:12-84  [code=1.10.220.10, no name defined]                     1aowA02 A:85-158  [code=1.10.220.10, no name defined]                     1aowA03 A:159-244  [code=1.10.220.10, no name defined]                                1aowA04 A:245-316  [code=1.10.220.10, no name defined]                  -- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhh......hhhhhhhhhh..hhhhhhhhhhhhhhh...hhhhhhhh..hhhhhhhhhhh..hhhhhhhhhhhhh......hhhhhhhhhh..hhhhhhhhhhhhhhh...hhhhhhhh..hhhhhhhhhhhh..........hhhhhhhhhhhhhhhh......hhhhhhhhhh..hhhhhhhhhhhhhhh...hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh....hhhhhhhhhhhh...hhhhhhhh..hhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------ANNEXIN  PDB: A:30-82 UniProt: 31-83                 -------------------ANNEXIN  PDB: A:102-154 UniProt: 103-155             -------------------------------ANNEXIN  PDB: A:186-238 UniProt: 187-239             ----------------------ANNEXIN  PDB: A:261-313 UniProt: 262-314             ----- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: A:10-3-------------------------------Exon 1.8  PDB: A:62-99 UniProt: 63-100Exon 1.10  PDB: A:100-130      --------------------------Exon 1.12          Exon 1.13  PDB: A:176-207       -------------------------------Exon 1.15           Exon 1.16  PDB: A:259-299                Exon 1.17           Transcript 1 (1)
           Transcript 1 (2) --------------------Exon 1.4  PDB: A:30-61          --------------------------------------------------------------------Exon 1.11  PDB: A:130-156  --------------------------------------------------Exon 1.14  PDB: A:207-239        ------------------------------------------------------------------------------- Transcript 1 (2)
                 1aow A  10 ASGFNAAEDAQTLRKAMKGLGTDEDAIINVLAYRSTAQRQEIRTAYKTTIGRDLMDDLKSELSGNFEQVILGMMTPTVLYDVQEVRKAMKGAGTDEGCLIEILASRTPEEIRRINQTYQLQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDESNYLDDALMRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRIAQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAERLYKSMKGLGTDDDTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSFIKGDTSGDYRKVLLILCGGDD 318
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1AOW)

(-) Gene Ontology  (24, 24)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (ANXA4_BOVIN | P13214)
molecular function
    GO:0051059    NF-kappaB binding    Interacting selectively and non-covalently with NF-kappaB, a transcription factor for eukaryotic RNA polymerase II promoters.
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0005544    calcium-dependent phospholipid binding    Interacting selectively and non-covalently with phospholipids, a class of lipids containing phosphoric acid as a mono- or diester, in the presence of calcium.
    GO:0048306    calcium-dependent protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules), in the presence of calcium.
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
    GO:0035374    chondroitin sulfate binding    Interacting selectively and non-covalently with chondroitin sulfate, a glycosaminoglycan made up of two alternating monosaccharides: D-glucuronic acid (GlcA) and N-acetyl-D-galactosamine (GalNAc).
    GO:0008201    heparin binding    Interacting selectively and non-covalently with heparin, any member of a group of glycosaminoglycans found mainly as an intracellular component of mast cells and which consist predominantly of alternating alpha-(1->4)-linked D-galactose and N-acetyl-D-glucosamine-6-sulfate residues.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
biological process
    GO:0007219    Notch signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to the receptor Notch on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0030855    epithelial cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of an epithelial cell, any of the cells making up an epithelium.
    GO:0032088    negative regulation of NF-kappaB transcription factor activity    Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of the transcription factor NF-kappaB.
    GO:2000483    negative regulation of interleukin-8 secretion    Any process that stops, prevents or reduces the frequency, rate or extent of interleukin-8 secretion.
    GO:0006357    regulation of transcription from RNA polymerase II promoter    Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
cellular component
    GO:0016324    apical plasma membrane    The region of the plasma membrane located at the apical end of the cell.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0042584    chromaffin granule membrane    The lipid bilayer surrounding a chromaffin granule, a specialized secretory vesicle found in the cells of adrenal glands and various other organs, which is concerned with the synthesis, storage, metabolism, and secretion of epinephrine and norepinephrine.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0031965    nuclear membrane    Either of the lipid bilayers that surround the nucleus and form the nuclear envelope; excludes the intermembrane space.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0048471    perinuclear region of cytoplasm    Cytoplasm situated near, or occurring around, the nucleus.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0012506    vesicle membrane    The lipid bilayer surrounding any membrane-bounded vesicle in the cell.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1aow)
 
  Sites
(no "Sites" information available for 1aow)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1aow)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1aow
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ANXA4_BOVIN | P13214
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ANXA4_BOVIN | P13214
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ANXA4_BOVIN | P132141ann 1i4a

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1AOW)