Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  N-TERMINAL ACTIN-CROSSLINKING DOMAIN FROM HUMAN FIMBRIN
 
Authors :  S. C. Goldsmith, N. Pokala, W. Shen, A. A. Fedorov, P. Matsudaira, S. C. Almo
Date :  30 Jun 97  (Deposition) - 31 Dec 97  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym./Biol. Unit :  A
Keywords :  Actin-Binding Protein, Calcium-Binding, Phosphorylation (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. C. Goldsmith, N. Pokala, W. Shen, A. A. Fedorov, P. Matsudaira, S. C. Almo
The Structure Of An Actin-Crosslinking Domain From Human Fimbrin.
Nat. Struct. Biol. V. 4 708 1997
PubMed-ID: 9302997  |  Reference-DOI: 10.1038/NSB0997-708
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - T-FIMBRIN
    ChainsA
    FragmentABD1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1AOA)

(-) Sites  (0, 0)

(no "Site" information available for 1AOA)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1AOA)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Ile A:147 -Pro A:148

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1AOA)

(-) PROSITE Motifs  (3, 4)

Asymmetric/Biological Unit (3, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CHPS50021 Calponin homology domain profile.PLST_HUMAN123-239
267-378
397-506
518-627
  2A:123-239
A:267-375
-
-
2ACTININ_1PS00019 Actinin-type actin-binding domain signature 1.PLST_HUMAN125-134
399-408
  1A:125-134
-
3ACTININ_2PS00020 Actinin-type actin-binding domain signature 2.PLST_HUMAN211-235
478-502
  1A:211-235
-

(-) Exons   (7, 7)

Asymmetric/Biological Unit (7, 7)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1cENST000003558991cENSE00001456427X:114795509-11479558779PLST_HUMAN-00--
1.3ENST000003558993ENSE00002171961X:114844555-11484463581PLST_HUMAN1-25250--
1.6ENST000003558996ENSE00000893705X:114856558-114856721164PLST_HUMAN25-79550--
1.8ENST000003558998ENSE00000893704X:114863510-114863639130PLST_HUMAN80-123441A:121-1233
1.9cENST000003558999cENSE00001702745X:114864147-114864279133PLST_HUMAN123-167451A:123-16745
1.10aENST0000035589910aENSE00001796931X:114868312-11486839382PLST_HUMAN167-194281A:167-19428
1.11ENST0000035589911ENSE00001592354X:114869193-114869358166PLST_HUMAN195-250561A:195-25056
1.12ENST0000035589912ENSE00000675060X:114871148-114871290143PLST_HUMAN250-297481A:250-297 (gaps)48
1.15bENST0000035589915bENSE00000675079X:114874720-11487481596PLST_HUMAN298-329321A:298-32932
1.16bENST0000035589916bENSE00000675108X:114877625-114877820196PLST_HUMAN330-395661A:330-37546
1.17ENST0000035589917ENSE00000675119X:114879341-11487941979PLST_HUMAN395-421270--
1.18bENST0000035589918bENSE00000675120X:114880392-114880506115PLST_HUMAN421-459390--
1.19bENST0000035589919bENSE00001687130X:114880722-114880855134PLST_HUMAN460-504450--
1.20aENST0000035589920aENSE00000675128X:114881870-114881993124PLST_HUMAN504-545420--
1.21ENST0000035589921ENSE00001279832X:114882213-114882337125PLST_HUMAN546-587420--
1.22dENST0000035589922dENSE00001429565X:114883749-1148851771429PLST_HUMAN587-630440--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:247
 aligned with PLST_HUMAN | P13797 from UniProtKB/Swiss-Prot  Length:630

    Alignment length:255
                                   130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370     
           PLST_HUMAN   121 YSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFN 375
               SCOP domains d1aoaa1 A:121-251 Fimbrin (Plastin), actin-crosslinking domain                                                                     --------d1aoaa2 A:260-375 Fimbrin (Plastin), actin-crosslinking domain                                                       SCOP domains
               CATH domains 1aoaA01 A:121-238 Actin-binding Protein, T-fimbrin; domain 1                                                          1aoaA02 A:239        -374 Actin-binding Protein, T-fimbrin; domain 1                                                                    - CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh.................hhhhhhhhh.hhhhhhhhhh......hhh.......hhhhhhhhhhhhhhhhh.........hhhhh...hhhhhhhhhhhhhhhhhhhhh.......--------.hhhhhh..hhhhhhhhhhhhhhh................hhhhhhhhhh.......................hhhhhhhhhhhh..........hhhhh...hhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --CH  PDB: A:123-239 UniProt: 123-239                                                                                  ---------------------------CH  PDB: A:267-375 UniProt: 267-378                                                                           PROSITE (1)
                PROSITE (2) ----ACTININ_1 ----------------------------------------------------------------------------ACTININ_2  PDB: A:211-235-------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) 1.8-------------------------------------------Exon 1.10a  PDB: A:167-194  Exon 1.11  PDB: A:195-250 UniProt: 195-250              -----------------------------------------------Exon 1.15b  PDB: A:298-329      Exon 1.16b  PDB: A:330-375 UniProt: 330-395    Transcript 1 (1)
           Transcript 1 (2) --Exon 1.9c  PDB: A:123-167 UniProt: 123-167   ----------------------------------------------------------------------------------Exon 1.12  PDB: A:250-297 (gaps)                ------------------------------------------------------------------------------ Transcript 1 (2)
                 1aoa A 121 YSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEAL--------TLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFN 375
                                   130       140       150       160       170       180       190       200       210       220       230       240       250|      260       270       280       290       300       310       320       330       340       350       360       370     
                                                                                                                                                            251      260                                                                                                                   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1AOA)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (PLST_HUMAN | P13797)
molecular function
    GO:0003779    actin binding    Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0042491    auditory receptor cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of an auditory hair cell.
    GO:0060348    bone development    The process whose specific outcome is the progression of bone over time, from its formation to the mature structure. Bone is the hard skeletal connective tissue consisting of both mineral and cellular components.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0032420    stereocilium    An actin-based protrusion from the apical surface of auditory and vestibular hair cells and of neuromast cells. These protrusions are supported by a bundle of cross-linked actin filaments (an actin cable), oriented such that the plus (barbed) ends are at the tip of the protrusion, capped by a tip complex which bridges to the plasma. Bundles of stereocilia act as mechanosensory organelles.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1aoa)
 
  Sites
(no "Sites" information available for 1aoa)
 
  Cis Peptide Bonds
    Ile A:147 - Pro A:148   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
Molmol
  protein, nucleic acid: cartoon; ligands: spacefill; active site: sticks
Prepi
  ribbon, secondary structure
  ribbon, secondary structure, sequence, labeling

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1aoa
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PLST_HUMAN | P13797
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PLST_HUMAN | P13797
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PLST_HUMAN | P137971wjo

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1AOA)