1AJW - JenaLib

Title :   STRUCTURE OF RHOGDI: A C-TERMINAL BINDING DOMAIN TARGETS AN N-TERMINAL INHIBITORY PEPTIDE TO GTPASES, NMR, 20 STRUCTURES

Authors :   M. K. Rosen, Y. Q. Gosser

Date :   11 May 97 (Deposition) - 19 Nov 97 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Rho-Gtpase Inhibitor, Nucleotide Exchange, Isoprene Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Q. Gosser, T. K. Nomanbhoy, B. Aghazadeh, D. Manor, C. Combs, R. A. Cerione, M. K. Rosen
C-Terminal Binding Domain Of Rho Gdp-Dissociation Inhibitor Directs N-Terminal Inhibitory Peptide To Gtpases.
Nature V. 387 814 1997
PubMed-ID: 9194563 | Reference-DOI: 10.1038/42961
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (5, 5)

NMR Structure (5, 5)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENSBTAT00000042645	1a	ENSBTAE00000313955	chr19:52509068-52509114	47	GDIR1_BOVIN	-	0	0	-	-
1.2a	ENSBTAT00000042645	2a	ENSBTAE00000313954	chr19:52510634-52510850	217	GDIR1_BOVIN	1-64	64	1	A:60-64	5
1.3b	ENSBTAT00000042645	3b	ENSBTAE00000415332	chr19:52510952-52511035	84	GDIR1_BOVIN	64-92	29	1	A:64-92	29
1.4a	ENSBTAT00000042645	4a	ENSBTAE00000385033	chr19:52511376-52511458	83	GDIR1_BOVIN	92-119	28	1	A:92-119	28
1.5	ENSBTAT00000042645	5	ENSBTAE00000384180	chr19:52511539-52511602	64	GDIR1_BOVIN	120-141	22	1	A:120-141	22
1.6b	ENSBTAT00000042645	6b	ENSBTAE00000313946	chr19:52511721-52513082	1362	GDIR1_BOVIN	141-206	66	1	A:141-204	64

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:145
 aligned with GDIR1_BOVIN | P19803 from UniProtKB/Swiss-Prot  Length:204

    Alignment length:145
                                    69        79        89        99       109       119       129       139       149       159       169       179       189       199     
          GDIR1_BOVIN    60 AVSADPNVPNVVVTRLTLVCSTAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPMEEAPKGMLARGSYNIKSRFTDDDRTDHLSWEWNLTIKKEWKD 204
               SCOP domains d1ajwa_ A: Rho GDP-dissociation inhibitor 1, RhoGDI                                                                                               SCOP domains
               CATH domains 1ajwA00 A:60-204 Coagulation Factor XIII, subunit A, domain 1                                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eeeeeeeee................hhhhh.eeeee.....eeeeeeee....eeeeeeeeeee.......eeeee.eee.....eee...............eeeeeeeee........eeeeeeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.2a ---------------------------Exon 1.4a  PDB: A:92-119    Exon 1.5              --------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----Exon 1.3b  PDB: A:64-92      ------------------------------------------------Exon 1.6b  PDB: A:141-204 UniProt: 141-206 [INCOMPLETE]          Transcript 1 (2)
                 1ajw A  60 AVSADPNVPNVVVTRLTLVCSTAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPMEEAPKGMLARGSYNIKSRFTDDDRTDHLSWEWNLTIKKEWKD 204
                                    69        79        89        99       109       119       129       139       149       159       169       179       189       199

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (11, 11)

NMR Structure(hide GO term definitions)

Chain A (GDIR1_BOVIN | P19803)

molecular function
	GO:0005096	GTPase activator activity	Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
	GO:0005094	Rho GDP-dissociation inhibitor activity	Prevents the dissociation of GDP from the small GTPase Rho, thereby preventing GTP from binding.
biological process
	GO:0007266	Rho protein signal transduction	A series of molecular signals within the cell that are mediated by a member of the Rho family of proteins switching to a GTP-bound active state.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0050790	regulation of catalytic activity	Any process that modulates the activity of an enzyme.
	GO:0032880	regulation of protein localization	Any process that modulates the frequency, rate or extent of any process in which a protein is transported to, or maintained in, a specific location.
	GO:0071526	semaphorin-plexin signaling pathway	A series of molecular signals generated as a consequence of a semaphorin receptor (composed of a plexin and a neurophilin) binding to a semaphorin ligand.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0001772	immunological synapse	An area of close contact between a lymphocyte (T-, B-, or natural killer cell) and a target cell formed through the clustering of particular signaling and adhesion molecules and their associated membrane rafts on both the lymphocyte and the target cell and facilitating activation of the lymphocyte, transfer of membrane from the target cell to the lymphocyte, and in some situations killing of the target cell through release of secretory granules and/or death-pathway ligand-receptor interaction.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ajw)

	Sites
(no "Sites" information available for 1ajw)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ajw)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1ajw
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GDIR1_BOVIN \| P19803
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GDIR1_BOVIN \| P19803
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description