1AFO - JenaLib

Title :   DIMERIC TRANSMEMBRANE DOMAIN OF HUMAN GLYCOPHORIN A, NMR, 20 STRUCTURES

Authors :   K. R. Mackenzie, J. H. Prestegard, D. M. Engelman

Date :   11 Mar 97 (Deposition) - 17 Sep 97 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A,B  (20x)

Keywords :   Integral Membrane Protein, Human Glycophorin A, Transmembrane Helix Interactions, Membrane Protein Folding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. R. Mackenzie, J. H. Prestegard, D. M. Engelman
A Transmembrane Helix Dimer: Structure And Implications.
Science V. 276 131 1997
PubMed-ID: 9082985 | Reference-DOI: 10.1126/SCIENCE.276.5309.131
(for further references see the PDB file header)

Compounds

Molecule 1 - GLYCOPHORIN A
	Cell	:	ERYTHROCYTE
	Cellular Location	:	PLASMA MEMBRANE
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET3A
	Expression System Strain	:	MG-T7
	Expression System Taxid	:	562
	Fragment	:	TRANSMEMBRANE PEPTIDE
	Organ	:	PLASMA
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Strain	:	MG-T7

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 4)

PROSITE Motifs (1, 2)

Exons (3, 6)

NMR Structure (3, 6)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000360771	1a	ENSE00001721810	chr4:145061904-145061752	153	GLPA_HUMAN	1-13	13	0	-	-
1.3	ENST00000360771	3	ENSE00001680915	chr4:145041741-145041643	99	GLPA_HUMAN	13-46	34	0	-	-
1.4a	ENST00000360771	4a	ENSE00001139681	chr4:145040934-145040839	96	GLPA_HUMAN	46-78	33	0	-	-
1.5a	ENST00000360771	5a	ENSE00001139707	chr4:145039905-145039867	39	GLPA_HUMAN	78-91	14	2	A:62-72 B:62-72	11 11
1.6a	ENST00000360771	6a	ENSE00001139697	chr4:145038092-145038007	86	GLPA_HUMAN	91-119	29	2	A:72-100 B:72-100	29 29
1.7b	ENST00000360771	7b	ENSE00001133833	chr4:145035920-145035842	79	GLPA_HUMAN	120-146	27	2	A:101-101 B:101-101	1 1
1.8f	ENST00000360771	8f	ENSE00001200737	chr4:145032563-145030457	2107	GLPA_HUMAN	146-150	5	0	-	-

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:40
 aligned with GLPA_HUMAN | P02724 from UniProtKB/Swiss-Prot  Length:150

    Alignment length:40
                                    90       100       110       120
           GLPA_HUMAN    81 VQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKK 120
               SCOP domains d1afoa_ A:                               SCOP domains
               CATH domains 1afoA00 A:62-101                         CATH domains
               Pfam domains ---------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -K-P------------------------------------ SAPs(SNPs)
                    PROSITE --------------GLYCOPHORI---------------- PROSITE
           Transcript 1 (1) Exon 1.5a  ----------------------------1 Transcript 1 (1)
           Transcript 1 (2) ----------Exon 1.6a  PDB: A:72-100     - Transcript 1 (2)
                 1afo A  62 VQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKK 101
                                    71        81        91       101

Chain B from PDB  Type:PROTEIN  Length:40
 aligned with GLPA_HUMAN | P02724 from UniProtKB/Swiss-Prot  Length:150

    Alignment length:40
                                    90       100       110       120
           GLPA_HUMAN    81 VQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKK 120
               SCOP domains d1afob_ B:                               SCOP domains
               CATH domains 1afoB00 B:62-101                         CATH domains
               Pfam domains ---------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -K-P------------------------------------ SAPs(SNPs)
                    PROSITE --------------GLYCOPHORI---------------- PROSITE
           Transcript 1 (1) Exon 1.5a  ----------------------------1 Transcript 1 (1)
           Transcript 1 (2) ----------Exon 1.6a  PDB: B:72-100     - Transcript 1 (2)
                 1afo B  62 VQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKK 101
                                    71        81        91       101

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (8, 8)

NMR Structure(hide GO term definitions)

Chain A,B (GLPA_HUMAN | P02724)

molecular function
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0001618	virus receptor activity	Combining with a virus component and mediating entry of the virus into the cell.
biological process
	GO:0046718	viral entry into host cell	The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1afo)

	Sites
(no "Sites" information available for 1afo)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1afo)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1afo
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GLPA_HUMAN \| P02724
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GLPA_HUMAN \| P02724
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description