1A12 - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Title :   REGULATOR OF CHROMOSOME CONDENSATION (RCC1) OF HUMAN

Authors :   L. Renault, N. Nassar, I. Vetter, J. Becker, M. Roth, A. Wittinghofer

Date :   19 Dec 97 (Deposition) - 13 Jan 99 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.70

Chains :   Asym./Biol. Unit : A,B,C

Keywords :   Guanine Nucleotide Exchange Factor, Gef, Ran, Ras-Like Nuclear Gtp Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   L. Renault, N. Nassar, I. Vetter, J. Becker, C. Klebe, M. Roth, A. Wittinghofer
The 1. 7 A Crystal Structure Of The Regulator Of Chromosome Condensation (Rcc1) Reveals A Seven-Bladed Propeller.
Nature V. 392 97 1998
PubMed-ID: 9510255 | Reference-DOI: 10.1038/32204
(for further references see the PDB file header)

Molecule 1 - REGULATOR OF CHROMOSOME CONDENSATION 1
	Chains	:	A, B, C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PTAC
	Expression System Strain	:	CK600K
	Expression System Taxid	:	562
	Fragment	:	FULL LENGTH
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	RCC1

		1	2	3
Asymmetric/Biological Unit	:	A	B	C

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1A12)

(no "Site" information available for 1A12)

(no "SS Bond" information available for 1A12)

(no "Cis Peptide Bond" information available for 1A12)

(no "SAP(SNP)/Variant" information available for 1A12)

Asymmetric/Biological Unit (3, 36)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RCC1_3	PS50012	Regulator of chromosome condensation (RCC1) repeat profile.	RCC1_HUMAN	35-85 86-137 138-190 191-258 259-312 313-363 364-417	21	A:35-85 B:35-85 C:35-85 A:86-137 B:86-137 C:86-137 A:138-190 B:138-190 C:138-190 A:191-258 B:191-258 C:191-258 A:259-312 B:259-312 C:259-312 A:313-363 B:313-363 C:313-363 A:364-417 B:364-417 C:364-417
2	RCC1_1	PS00625	Regulator of chromosome condensation (RCC1) signature 1.	RCC1_HUMAN	92-103	3	A:92-103 B:92-103 C:92-103
3	RCC1_2	PS00626	Regulator of chromosome condensation (RCC1) signature 2.	RCC1_HUMAN	124-134 177-187 299-309 404-414	12	A:124-134 B:124-134 C:124-134 A:177-187 B:177-187 C:177-187 A:299-309 B:299-309 C:299-309 A:404-414 B:404-414 C:404-414

Asymmetric/Biological Unit (9, 27)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000398958	1a	ENSE00001461695	chr1:28832496-28832596	101	RCC1_HUMAN	-	0	0	-	-
1.2	ENST00000398958	2	ENSE00002156964	chr1:28834640-28834672	33	RCC1_HUMAN	-	0	0	-	-
1.3b	ENST00000398958	3b	ENSE00001461694	chr1:28835342-28835417	76	RCC1_HUMAN	-	0	0	-	-
1.8b	ENST00000398958	8b	ENSE00001684969	chr1:28856370-28856451	82	RCC1_HUMAN	1-25	25	3	A:21-25 B:21-25 C:21-25	5 5 5
1.10a	ENST00000398958	10a	ENSE00001273582	chr1:28858315-28858502	188	RCC1_HUMAN	25-87	63	3	A:25-87 B:25-87 C:25-87	63 63 63
1.11	ENST00000398958	11	ENSE00001273575	chr1:28858683-28858862	180	RCC1_HUMAN	88-147	60	3	A:88-147 B:88-147 C:88-147	60 60 60
1.13	ENST00000398958	13	ENSE00001273568	chr1:28861562-28861658	97	RCC1_HUMAN	148-180	33	3	A:148-180 B:148-180 C:148-180	33 33 33
1.14	ENST00000398958	14	ENSE00001273562	chr1:28861770-28861892	123	RCC1_HUMAN	180-221	42	3	A:180-221 B:180-221 C:180-221	42 42 42
1.16d	ENST00000398958	16d	ENSE00002159912	chr1:28862383-28862538	156	RCC1_HUMAN	221-273	53	3	A:221-273 B:221-273 C:221-273	53 53 53
1.17c	ENST00000398958	17c	ENSE00001273554	chr1:28862774-28862893	120	RCC1_HUMAN	273-313	41	3	A:273-313 B:273-313 C:273-313	41 41 41
1.18b	ENST00000398958	18b	ENSE00001273551	chr1:28863259-28863411	153	RCC1_HUMAN	313-364	52	3	A:313-364 B:313-364 C:313-364	52 52 52
1.19e	ENST00000398958	19e	ENSE00001378938	chr1:28864344-28865607	1264	RCC1_HUMAN	364-421	58	3	A:364-421 B:364-421 C:364-421	58 58 58

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:401
 aligned with RCC1_HUMAN | P18754 from UniProtKB/Swiss-Prot  Length:421

    Alignment length:401
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420 
           RCC1_HUMAN    21 KKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS 421
               SCOP domains d1a12a_ A: Regulator of chromosome condensation RCC1                                                                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1a12A00 A:21-421 Regulator of chromosome condensation RCC1/ beta-lactamase inhibitor protein-II, BLIP-II                                                                                                                                                                                                                                                                                                          CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............eeeeee...................eee.....eeeeee...eeeeee....eeeee...............hhh..........eeeeee...eeeeee....eeeee.eee..eeee...........eee.....eeeeee...eeeeee....eeeee..........hhhh....hhhhhhhhh.................eeeeeee..eeeeee....eeeee.....................hhh......eeeeee...eeeeee....eeeee..hhh......................eeeeee...eeeeee....eeeee............................eeeeeeee...eeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------RCC1_3  PDB: A:35-85 UniProt: 35-85                RCC1_3  PDB: A:86-137 UniProt: 86-137               RCC1_3  PDB: A:138-190 UniProt: 138-190              RCC1_3  PDB: A:191-258 UniProt: 191-258                             RCC1_3  PDB: A:259-312 UniProt: 259-312               RCC1_3  PDB: A:313-363 UniProt: 313-363            RCC1_3  PDB: A:364-417 UniProt: 364-417               ---- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------RCC1_1      --------------------RCC1_2     ------------------------------------------RCC1_2     ---------------------------------------------------------------------------------------------------------------RCC1_2     ----------------------------------------------------------------------------------------------RCC1_2     ------- PROSITE (2)
           Transcript 1 (1) ----Exon 1.10a  PDB: A:25-87 UniProt: 25-87                        Exon 1.11  PDB: A:88-147 UniProt: 88-147                    Exon 1.13  PDB: A:148-180        ----------------------------------------Exon 1.16d  PDB: A:221-273 UniProt: 221-273          ---------------------------------------Exon 1.18b  PDB: A:313-364 UniProt: 313-364         --------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) 1.8b ----------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.14  PDB: A:180-221 UniProt: 180-221---------------------------------------------------Exon 1.17c  PDB: A:273-313               --------------------------------------------------Exon 1.19e  PDB: A:364-421 UniProt: 364-421                Transcript 1 (2)
                 1a12 A  21 KKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS 421
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420

Chain B from PDB  Type:PROTEIN  Length:401
 aligned with RCC1_HUMAN | P18754 from UniProtKB/Swiss-Prot  Length:421

    Alignment length:401
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420 
           RCC1_HUMAN    21 KKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS 421
               SCOP domains d1a12b_ B: Regulator of chromosome condensation RCC1                                                                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1a12B00 B:21-421 Regulator of chromosome condensation RCC1/ beta-lactamase inhibitor protein-II, BLIP-II                                                                                                                                                                                                                                                                                                          CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............eeeeee...................eee.....eeeeee...eeeeee....eeeee....................eee.....eeeeee...eeeeee....eeeee.............................eeeeee...eeeeee....eeeee...........hhh....hhh..hhhh.................eeeeeee..eeeeee....eeeee.....................hhh......eeeeee...eeeeee....eeeee..hhh......................eeeeee...eeeeee....eeeee.......................hhh..eeeeeeee...eeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------RCC1_3  PDB: B:35-85 UniProt: 35-85                RCC1_3  PDB: B:86-137 UniProt: 86-137               RCC1_3  PDB: B:138-190 UniProt: 138-190              RCC1_3  PDB: B:191-258 UniProt: 191-258                             RCC1_3  PDB: B:259-312 UniProt: 259-312               RCC1_3  PDB: B:313-363 UniProt: 313-363            RCC1_3  PDB: B:364-417 UniProt: 364-417               ---- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------RCC1_1      --------------------RCC1_2     ------------------------------------------RCC1_2     ---------------------------------------------------------------------------------------------------------------RCC1_2     ----------------------------------------------------------------------------------------------RCC1_2     ------- PROSITE (2)
           Transcript 1 (1) ----Exon 1.10a  PDB: B:25-87 UniProt: 25-87                        Exon 1.11  PDB: B:88-147 UniProt: 88-147                    Exon 1.13  PDB: B:148-180        ----------------------------------------Exon 1.16d  PDB: B:221-273 UniProt: 221-273          ---------------------------------------Exon 1.18b  PDB: B:313-364 UniProt: 313-364         --------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) 1.8b ----------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.14  PDB: B:180-221 UniProt: 180-221---------------------------------------------------Exon 1.17c  PDB: B:273-313               --------------------------------------------------Exon 1.19e  PDB: B:364-421 UniProt: 364-421                Transcript 1 (2)
                 1a12 B  21 KKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS 421
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420

Chain C from PDB  Type:PROTEIN  Length:401
 aligned with RCC1_HUMAN | P18754 from UniProtKB/Swiss-Prot  Length:421

    Alignment length:401
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420 
           RCC1_HUMAN    21 KKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS 421
               SCOP domains d1a12c_ C: Regulator of chromosome condensation RCC1                                                                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1a12C00 C:21-421 Regulator of chromosome condensation RCC1/ beta-lactamase inhibitor protein-II, BLIP-II                                                                                                                                                                                                                                                                                                          CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............eeeeee...........................eeeeee...eeeeee....eeeee...............hhh..........eeeeee...eeeeee....eeeee.............................eeeeee...eeeeee....eeeee..................hhh.hhhhh.................eeeeeee..eeeeee....eeeee.....................hhh......eeeeee...eeeeee....eeeee..hhh......................eeeeeee..eeeeee....eeeee............................eeeeeeee...eeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------RCC1_3  PDB: C:35-85 UniProt: 35-85                RCC1_3  PDB: C:86-137 UniProt: 86-137               RCC1_3  PDB: C:138-190 UniProt: 138-190              RCC1_3  PDB: C:191-258 UniProt: 191-258                             RCC1_3  PDB: C:259-312 UniProt: 259-312               RCC1_3  PDB: C:313-363 UniProt: 313-363            RCC1_3  PDB: C:364-417 UniProt: 364-417               ---- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------RCC1_1      --------------------RCC1_2     ------------------------------------------RCC1_2     ---------------------------------------------------------------------------------------------------------------RCC1_2     ----------------------------------------------------------------------------------------------RCC1_2     ------- PROSITE (2)
           Transcript 1 (1) ----Exon 1.10a  PDB: C:25-87 UniProt: 25-87                        Exon 1.11  PDB: C:88-147 UniProt: 88-147                    Exon 1.13  PDB: C:148-180        ----------------------------------------Exon 1.16d  PDB: C:221-273 UniProt: 221-273          ---------------------------------------Exon 1.18b  PDB: C:313-364 UniProt: 313-364         --------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) 1.8b ----------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.14  PDB: C:180-221 UniProt: 180-221---------------------------------------------------Exon 1.17c  PDB: C:273-313               --------------------------------------------------Exon 1.19e  PDB: C:364-421 UniProt: 364-421                Transcript 1 (2)
                 1a12 C  21 KKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS 421
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: 7-bladed beta-propeller (245)

Superfamily: RCC1/BLIP-II (5)

Family: Regulator of chromosome condensation RCC1 (2)

Protein domain: Regulator of chromosome condensation RCC1 (2)

Human (Homo sapiens) [TaxId: 9606] (2)

1a	d1a12a_	A:
1b	d1a12b_	B:
1c	d1a12c_	C:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: 7 Propellor (136)

Topology: Methylamine Dehydrogenase; Chain H (136)

Homologous Superfamily: Regulator of chromosome condensation RCC1/ beta-lactamase inhibitor protein-II, BLIP-II (3)

Human (Homo sapiens) (2)

1a	1a12A00	A:21-421
1b	1a12B00	B:21-421
1c	1a12C00	C:21-421

(no "Pfam Domain" information available for 1A12)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C (RCC1_HUMAN | P18754)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0005087	Ran guanyl-nucleotide exchange factor activity	Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Ran family. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
	GO:0003682	chromatin binding	Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
	GO:0005085	guanyl-nucleotide exchange factor activity	Stimulates the exchange of guanyl nucleotides associated with a GTPase. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
	GO:0042393	histone binding	Interacting selectively and non-covalently with a histone, any of a group of water-soluble proteins found in association with the DNA of eukaroytic chromosomes. They are involved in the condensation and coiling of chromosomes during cell division and have also been implicated in nonspecific suppression of gene activity.
	GO:0031492	nucleosomal DNA binding	Interacting selectively and non-covalently with the DNA portion of a nucleosome.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0000082	G1/S transition of mitotic cell cycle	The mitotic cell cycle transition by which a cell in G1 commits to S phase. The process begins with the build up of G1 cyclin-dependent kinase (G1 CDK), resulting in the activation of transcription of G1 cyclins. The process ends with the positive feedback of the G1 cyclins on the G1 CDK which commits the cell to S phase, in which DNA replication is initiated.
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:0007059	chromosome segregation	The process in which genetic material, in the form of chromosomes, is organized into specific structures and then physically separated and apportioned to two or more sets. In eukaryotes, chromosome segregation begins with the condensation of chromosomes, includes chromosome separation, and ends when chromosomes have completed movement to the spindle poles.
	GO:0007052	mitotic spindle organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the microtubule spindle during a mitotic cell cycle.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0007088	regulation of mitotic nuclear division	Any process that modulates the frequency, rate or extent of mitosis.
	GO:0051225	spindle assembly	The aggregation, arrangement and bonding together of a set of components to form the spindle, the array of microtubules and associated molecules that serves to move duplicated chromosomes apart.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0000794	condensed nuclear chromosome	A highly compacted molecule of DNA and associated proteins resulting in a cytologically distinct nuclear chromosome.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0000790	nuclear chromatin	The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome in the nucleus.
	GO:0031965	nuclear membrane	Either of the lipid bilayers that surround the nucleus and form the nuclear envelope; excludes the intermembrane space.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1a12)

	Sites
(no "Sites" information available for 1a12)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1a12)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1a12
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	RCC1_HUMAN \| P18754
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	RCC1_HUMAN \| P18754
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	RCC1_HUMAN \| P18754	:	1i2m 5e1b 5e1d 5e1m 5e1o 5e2a 5e2b

(no "Related Entries Specified in the PDB File" available for 1A12)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 36)

Exons (9, 27)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 3)

CATH Domains (1, 3)

Pfam Domains (0, 0)

Gene Ontology (22, 22)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File