|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 11) Biological Unit 1 (1, 10) Biological Unit 2 (1, 7) Biological Unit 3 (1, 6) |
(no "Site" information available for 1ZPV) |
(no "SS Bond" information available for 1ZPV) |
(no "Cis Peptide Bond" information available for 1ZPV) |
(no "SAP(SNP)/Variant" information available for 1ZPV) |
Asymmetric Unit (1, 3)
|
(no "Exon" information available for 1ZPV) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:85 aligned with Y238_STRPN | P67382 from UniProtKB/Swiss-Prot Length:88 Alignment length:85 1 | 8 18 28 38 48 58 68 78 Y238_STRPN - --MKAIITVVGKDKSGIVAGVSGKIAELGLNIDDISQTVLDEYFTMMAVVSSDEKQDFTYLRNEFEAFGQTLNVKINIQSAAIFE 83 SCOP domains --d1zpva1 A:1-83 UPF0237 protein SP0238 SCOP domains CATH domains 1zpvA00 A:-2-83 [code=3.30.70.260, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----ACT PDB: A:4-77 UniProt: 4-77 ------ PROSITE Transcript ------------------------------------------------------------------------------------- Transcript 1zpv A -2 NAmKAIITVVGKDKSGIVAGVSGKIAELGLNIDDISQTVLDEYFTmmAVVSSDEKQDFTYLRNEFEAFGQTLNVKINIQSAAIFE 83 || 8 18 28 38 || 48 58 68 78 || 44-MSE -1| 45-MSE 1-MSE Chain B from PDB Type:PROTEIN Length:84 aligned with Y238_STRPN | P67382 from UniProtKB/Swiss-Prot Length:88 Alignment length:84 1 | 9 19 29 39 49 59 69 79 Y238_STRPN - -MKAIITVVGKDKSGIVAGVSGKIAELGLNIDDISQTVLDEYFTMMAVVSSDEKQDFTYLRNEFEAFGQTLNVKINIQSAAIFE 83 SCOP domains d1zpvb_ B: UPF0237 protein SP0238 SCOP domains CATH domains 1zpvB00 B:-1-83 [code=3.30.70.260, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ----ACT PDB: B:4-77 UniProt: 4-77 ------ PROSITE Transcript ------------------------------------------------------------------------------------ Transcript 1zpv B -1 AmKAIITVVGKDKSGIVAGVSGKIAELGLNIDDISQTVLDEYFTmmAVVSSDEKQDFTYLRNEFEAFGQTLNVKINIQSAAIFE 83 || 9 19 29 39 || 49 59 69 79 -1| 44-MSE 1-MSE 45-MSE Chain C from PDB Type:PROTEIN Length:88 aligned with Y238_STRPN | P67382 from UniProtKB/Swiss-Prot Length:88 Alignment length:88 1 | 8 18 28 38 48 58 68 78 Y238_STRPN - --MKAIITVVGKDKSGIVAGVSGKIAELGLNIDDISQTVLDEYFTMMAVVSSDEKQDFTYLRNEFEAFGQTLNVKINIQSAAIFEAMY 86 SCOP domains d1zpvc_ C: UPF0237 protein SP0238 SCOP domains CATH domains 1zpvC00 C:-2-86 [code=3.30.70.260, no name defined] CATH domains Pfam domains (1) ---ACT_6-1zpvC01 C:2-77 --------- Pfam domains (1) Pfam domains (2) ---ACT_6-1zpvC02 C:2-77 --------- Pfam domains (2) Pfam domains (3) ---ACT_6-1zpvC03 C:2-77 --------- Pfam domains (3) SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----ACT PDB: C:4-77 UniProt: 4-77 --------- PROSITE Transcript ---------------------------------------------------------------------------------------- Transcript 1zpv C -2 NAmKAIITVVGKDKSGIVAGVSGKIAELGLNIDDISQTVLDEYFTmmAVVSSDEKQDFTYLRNEFEAFGQTLNVKINIQSAAIFEAmY 86 || 8 18 28 38 || 48 58 68 78 | -1| 44-MSE 85-MSE 1-MSE 45-MSE
|
Asymmetric Unit
|
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B,C (Y238_STRPN | P67382)
|
|
|
|
|
|
|