|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 3)| Asymmetric/Biological Unit (2, 3) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1ZLD) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1ZLD) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1ZLD) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1ZLD) |
Exons (0, 0)| (no "Exon" information available for 1ZLD) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:103 aligned with P78737_9PLEO | P78737 from UniProtKB/TrEMBL Length:178 Alignment length:118 70 80 90 100 110 120 130 140 150 160 170 P78737_9PLEO 61 QGSCMSITINPSRPSVNNIGQVDIDSVILGRPGAIGSWELNNFITIGLNRVNADTVRVNIRNTGRTNRLIITQWDNTVTRGDVYELFGDYALIQGRGSFCLNIRSDTGRENWRMQLEN 178 SCOP domains ---------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -T oxin_ToxA-1zldA01 A:62-178 Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript 1zld A 61 xG---------------NIGQVDIDSVILGRPGAIGSWELNNFITIGLNRVNADTVRVNIRNTGRTNRLIITQWDNTVTRGDVYELFGDYALIQGRGSFCLNIRSDTGRENWRMQLEN 178 || - |80 90 100 110 120 130 140 150 160 170 || 78 61-PCA 62
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 1ZLD) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1ZLD) |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1ZLD)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|