|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1Z2F) |
Sites (0, 0)| (no "Site" information available for 1Z2F) |
SS Bonds (5, 5)
NMR Structure
|
||||||||||||||||||||||||
Cis Peptide Bonds (1, 20)
NMR Structure
|
||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1Z2F) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1Z2F) |
Exons (0, 0)| (no "Exon" information available for 1Z2F) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:121 aligned with Q9GSA6_CHOFU | Q9GSA6 from UniProtKB/TrEMBL Length:138 Alignment length:121 27 37 47 57 67 77 87 97 107 117 127 137 Q9GSA6_CHOFU 18 DGTCVNTNSQITANSQCVKSTATNCYIDNSQLVDTSICTRSQYSDANVKKSVTTDCNIDKSQVYLTTCTGSQYNGIYIRSSTTTGTSISGPGCSISTCTITRGVATPAAACKISGCSLSAM 138 SCOP domains d1z2fa_ A: automated matches SCOP domains CATH domains 1z2fA00 A:1-121 [code=2.160.10.20, no name defined] CATH domains Pfam domains CfAFP-1z2fA01 A:1-121 Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript 1z2f A 1 DGTCVNTNSQITANSQCVKSTATNCYIDNSQLVDTSICTRSQYSDANVKKSVTTDCNIDKSQVYLTTCTGSQYNGIYIRSSTTTGTSISGPGCSISTCTITRGVATPAAACKISGCSLSAM 121 10 20 30 40 50 60 70 80 90 100 110 120
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 1Z2F)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|