Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR STRUCTURE OF CALSENSIN, 20 LOW ENERGY STRUCTURES.
 
Authors :  D. V. Venkitaramani, D. B. Fulton, A. H. Andreotti, K. M. Johansen, J. Johansen
Date :  19 Feb 05  (Deposition) - 05 Apr 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Calsensin, Calcium-Binding Protein, Ef-Hand, Helix-Loop- Helix, Nervous System, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. V. Venkitaramani, D. B. Fulton, A. H. Andreotti, K. M. Johansen, J. Johansen
Solution Structure And Backbone Dynamics Of Calsensin, An Invertebrate Neuronal Calcium-Binding Protein.
Protein Sci. V. 14 1894 2005
PubMed-ID: 15937283  |  Reference-DOI: 10.1110/PS.051412605
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CALSENSIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Plasmid: PGEX4T3
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Organism Scientific: HAEMOPIS MARMORATA
    Organism Taxid: 38567
    Synonym: LAN3-6 ANTIGEN

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1YX8)

(-) Sites  (0, 0)

(no "Site" information available for 1YX8)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1YX8)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1YX8)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1YX8)

(-) PROSITE Motifs  (2, 4)

NMR Structure (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF_HAND_2PS50222 EF-hand calcium-binding domain profile.CLSS_HAEMA4-39
46-81		  2A:4-39
A:46-81
2EF_HAND_1PS00018 EF-hand calcium-binding domain.CLSS_HAEMA17-29
59-71		  2A:17-29
A:59-71

(-) Exons   (0, 0)

(no "Exon" information available for 1YX8)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:83
 aligned with CLSS_HAEMA | Q25088 from UniProtKB/Swiss-Prot  Length:83

    Alignment length:83
                                    10        20        30        40        50        60        70        80   
            CLSS_HAEMA    1 MACKVKAELEAAFKKLDANGDGYVTALELQTFMVTLDAYKALSKDKVKEASAKLIKMADKNSDGKISKEEFLNANAELLCQLK 83
               SCOP domains d1yx8a_ A: automated matches                                                        SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhh.......hhhhhhhhhhhhh........hhhhhhhhhhhhhh.......hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---EF_HAND_2  PDB: A:4-39 UniProt: 4-39------EF_HAND_2  PDB: A:46-81             -- PROSITE (1)
                PROSITE (2) ----------------EF_HAND_1    -----------------------------EF_HAND_1    ------------ PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------- Transcript
                  1yx8 A  1 MACKVKAELEAAFKKLDANGDGYVTALELQTFMVTLDAYKALSKDKVKEASAKLIKMADKNSDGKISKEEFLNANAELLCQLK 83
                                    10        20        30        40        50        60        70        80
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1YX8)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1YX8)

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain A   (CLSS_HAEMA | Q25088)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1yx8)
 
  Sites
(no "Sites" information available for 1yx8)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1yx8)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1yx8
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CLSS_HAEMA | Q25088
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CLSS_HAEMA | Q25088
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CLSS_HAEMA | Q25088: 1yx7

(-) Related Entries Specified in the PDB File

1yx7 NMR STRUCTURE OF CALSENSIN, ENERGY MINIMIZED AVERAGE STRUCTURE