2K07 - JenaLib

Title :   SOLUTION NMR STRUCTURE OF HUMAN E2-LIKE UBIQUITIN-FOLD MODIFIER CONJUGATING ENZYME 1 (UFC1). NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET HR41

Authors :   G. Liu, A. Eletsky, H. S. Atreya, J. M. Aramini, R. Xiao, T. Acton, G. T. Montelione, T. Szyperski, Northeast Structural Genomics Consortium (Nesg)

Date :   25 Jan 08 (Deposition) - 19 Feb 08 (Release) - 29 Sep 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Ufc1, Ubiquitin Conjugating Enzyme, E2, Ufm1, Polymorphism, Ubl Conjugation Pathway, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   G. Liu, F. Forouhar, A. Eletsky, H. S. Atreya, J. M. Aramini, R. Xiao, Y. J. Huang, M. Abashidze, J. Seetharaman, J. Liu, B. Rost, T. Acton, G. T. Montelione, J. F. Hunt, T. Szyperski
Nmr And X-Ray Structures Of Human E2-Like Ubiquitin-Fold Modifier Conjugating Enzyme 1 (Ufc1) Reveal Structural And Functional Conservation In The Metazoan Ufm1-Uba5-Ufc1 Ubiquination Pathway.
J. Struct. Funct. Genom. V. 10 127 2009
PubMed-ID: 19101823 | Reference-DOI: 10.1007/S10969-008-9054-7
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 40)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (0, 0)

Exons (6, 6)

NMR Structure (6, 6)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.3a	ENST00000368003	3a	ENSE00001446105	chr1:161123542-161123910	369	UFC1_HUMAN	1-41	41	1	A:1-41	41
1.4a	ENST00000368003	4a	ENSE00000958732	chr1:161126740-161126807	68	UFC1_HUMAN	42-64	23	1	A:42-64	23
1.4c	ENST00000368003	4c	ENSE00001132692	chr1:161127044-161127107	64	UFC1_HUMAN	64-85	22	1	A:64-85	22
1.5a	ENST00000368003	5a	ENSE00001132687	chr1:161127407-161127483	77	UFC1_HUMAN	86-111	26	1	A:86-111	26
1.5d	ENST00000368003	5d	ENSE00001132682	chr1:161127911-161128001	91	UFC1_HUMAN	111-141	31	1	A:111-141	31
1.6b	ENST00000368003	6b	ENSE00001446104	chr1:161128202-161128646	445	UFC1_HUMAN	142-167	26	1	A:142-167	26

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:175
 aligned with UFC1_HUMAN | Q9Y3C8 from UniProtKB/Swiss-Prot  Length:167

    Alignment length:175
                                                                                                                                                                                                167        
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160      |  -     
           UFC1_HUMAN     1 MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ--------   -
               SCOP domains d2k07a_ A: Ufm1-conjugating enzyme 1, UFC1                                                                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhh....eeeee.....eeeeeeeeee..eeeeeeeeee..................................hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh................... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------C------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3a  PDB: A:1-41 UniProt: 1-41     Exon 1.4a  PDB: A:42-64---------------------Exon 1.5a  PDB: A:86-111  ------------------------------Exon 1.6b  PDB: A:142-167 -------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------Exon 1.4c  PDB: A:64-8-------------------------Exon 1.5d  PDB: A:111-141      ---------------------------------- Transcript 1 (2)
                 2k07 A   1 MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQLEHHHHHH 175
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (6, 6)

NMR Structure(hide GO term definitions)

Chain A (UFC1_HUMAN | Q9Y3C8)

molecular function
	GO:0071568	UFM1 transferase activity	Catalysis of the transfer of UFM1 from one protein to another via the reaction X-UFM1 + Y --> Y-UFM1 + X, where both X-UFM1 and Y-UFM1 are covalent linkages.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:1990592	protein K69-linked ufmylation	A protein ufmylation process in which a polymer of the ubiquitin-like protein UFM1 is formed by linkages between lysine residues at position 69 of the UFM1 monomers, is added to a protein.
	GO:0071569	protein ufmylation	Covalent attachment of the ubiquitin-like protein UFM1 to another protein.
	GO:0034976	response to endoplasmic reticulum stress	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stress acting at the endoplasmic reticulum. ER stress usually results from the accumulation of unfolded or misfolded proteins in the ER lumen.
cellular component
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2k07)

	Sites
(no "Sites" information available for 2k07)

	Cis Peptide Bonds
		Tyr A:90 - Pro A:91	[ RasMol ]
		Val A:129 - Pro A:130	[ RasMol ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2k07
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	UFC1_HUMAN \| Q9Y3C8
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	UFC1_HUMAN \| Q9Y3C8
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description