|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1YJJ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1YJJ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1YJJ) |
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1YJJ) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:106 aligned with PUTX_PSEPU | P00259 from UniProtKB/Swiss-Prot Length:107 Alignment length:106 11 21 31 41 51 61 71 81 91 101 PUTX_PSEPU 2 SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW 107 SCOP domains d1yjja_ A: 2Fe-2S ferredoxin SCOP domains CATH domains 1yjjA00 A:1-106 [code=3.10.20.30, no name defined] CATH domains Pfam domains -----Fer2-1yjjA01 A:6-91 --------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) 2FE2S_FER_2 PDB: A:1-105 UniProt: 2-106 - PROSITE (1) PROSITE (2) --------------------------------------ADX --------------------------------------------------------- PROSITE (2) Transcript ---------------------------------------------------------------------------------------------------------- Transcript 1yjj A 1 SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW 106 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (PUTX_PSEPU | P00259)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|