|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1YG2) |
Sites (0, 0)| (no "Site" information available for 1YG2) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1YG2) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1YG2) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1YG2) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1YG2) |
Exons (0, 0)| (no "Exon" information available for 1YG2) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:169 aligned with Q9X399_VIBCL | Q9X399 from UniProtKB/TrEMBL Length:179 Alignment length:178 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 Q9X399_VIBCL 2 SLPHVILTVLSTRDATGYDITKEFSASIGYFWKASHQQVYRELNKMGEQGLVTCVLEPQEGKPDRKVYSITQAGRSALGEWFDQPTAHPTVRDEFSAKLMACSVQSAEPYRLQLAELVEESRKLVAHYQEIEAAYYANPAVLDKQQRLERLTLRRNLLVRQAWIQWADEVLAELNAMA 179 SCOP domains d1yg2a_ A: Hypothetical protein AphA SCOP domains CATH domains 1yg2A01 A:2-89 'winged helix' repressor DNA binding domai n ------------------------------------------------------------------------------------------ CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1yg2 A 2 SLPHVILTVLSTRDATGYDITKEFSASIGYFWKASHQQVYRELNKMGEQGLVTCVLE---------VYSITQAGRSALGEWFDQPTAHPTVRDEFSAKLMACSVQSAEPYRLQLAELVEESRKLVAHYQEIEAAYYANPAVLDKQQRLERLTLRRNLLVRQAWIQWADEVLAELNAMA 179 11 21 31 41 51 | - | 71 81 91 101 111 121 131 141 151 161 171 58 68
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1YG2) |
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A (Q9X399_VIBCL | Q9X399)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|