|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)
Asymmetric Unit (2, 4)
|
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1YCA) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1YCA) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1YCA) |
PROSITE Motifs (1, 2)
Asymmetric Unit (1, 2)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1YCA) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:153 aligned with MYG_PIG | P02189 from UniProtKB/Swiss-Prot Length:154 Alignment length:153 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 MYG_PIG 2 GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDMAAKYKELGFQG 154 SCOP domains d1ycaa_ A: Myoglobin SCOP domains CATH domains 1ycaA00 A:1-153 Globins CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -GLOBIN PDB: A:2-147 UniProt: 3-148 ------ PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1yca A 1 GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGNTTLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 Chain B from PDB Type:PROTEIN Length:153 aligned with MYG_PIG | P02189 from UniProtKB/Swiss-Prot Length:154 Alignment length:153 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 MYG_PIG 2 GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDMAAKYKELGFQG 154 SCOP domains d1ycab_ B: Myoglobin SCOP domains CATH domains 1ycaB00 B:1-153 Globins CATH domains Pfam domains (1) -----Globin-1ycaB01 B:6-112 ----------------------------------------- Pfam domains (1) Pfam domains (2) -----Globin-1ycaB02 B:6-112 ----------------------------------------- Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -GLOBIN PDB: B:2-147 UniProt: 3-148 ------ PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1yca B 1 GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGNTTLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)
Asymmetric Unit
|
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (6, 6)|
Asymmetric Unit(hide GO term definitions) Chain A,B (MYG_PIG | P02189)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|