Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  MURA INHIBITED BY A DERIVATIVE OF 5-SULFONOXY-ANTHRANILIC ACID
 
Authors :  S. Eschenburg, M. A. Priestman, F. A. Abdul-Latif, C. Delachaume, F. Fa E. Schonbrunn
Date :  20 Dec 04  (Deposition) - 15 Feb 05  (Release) - 27 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Inside-Out Alpha-Beta Barrel, Transferase, Transferase-Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Eschenburg, M. A. Priestman, F. A. Abdul-Latif, C. Delachaume, F. Fassy, E. Schonbrunn
A Novel Inhibitor That Suspends The Induced Fit Mechanism O Udp-N-Acetylglucosamine Enolpyruvyl Transferase (Mura).
J. Biol. Chem. V. 280 14070 2005
PubMed-ID: 15701635  |  Reference-DOI: 10.1074/JBC.M414412200

(-) Compounds

Molecule 1 - UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYLTRANSFERASE
    Chains: A, B, C, D
    EC Number: 2.5.1.7
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET 9D
    Expression System Strain: BL21 DE3
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: MURA, MURZ
    Mutation: YES
    Organism Scientific: ENTEROBACTER CLOACAE
    Organism Taxid: 550
    Synonym: ENOYLPYRUVATE TRANSFERASE, UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE, EPT

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 8)

Asymmetric/Biological Unit (2, 8)
No.NameCountTypeFull Name
1IAS4Mod. Amino AcidBETA-L-ASPARTIC ACID
2TAV4Ligand/IonN-METHYL-N-{2-[(2-NAPHTHYLSULFONYL)AMINO]-5-[(2-NAPHTHYLSULFONYL)OXY]BENZOYL}-L-ASPARTIC ACID

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELYS A:22 , ASN A:23 , LEU A:26 , ARG A:91 , ILE A:94 , TRP A:95 , PRO A:121 , HIS A:125 , VAL A:163 , GLY A:164 , PHE A:328 , HOH A:514 , HOH A:533BINDING SITE FOR RESIDUE TAV A 550
2AC2SOFTWARELYS B:22 , ASN B:23 , LEU B:26 , ARG B:91 , ALA B:92 , ILE B:94 , TRP B:95 , PRO B:121 , HIS B:125 , VAL B:163 , GLY B:164 , GLU B:190 , PHE B:328 , HOH B:499BINDING SITE FOR RESIDUE TAV B 650
3AC3SOFTWARELYS C:22 , ASN C:23 , LEU C:26 , ARG C:91 , ALA C:92 , ILE C:94 , TRP C:95 , PRO C:121 , HIS C:125 , GLY C:164 , PHE C:328 , HOH C:452BINDING SITE FOR RESIDUE TAV C 750
4AC4SOFTWARELYS D:22 , ASN D:23 , LEU D:26 , ARG D:91 , ALA D:92 , ILE D:94 , PRO D:121 , HIS D:125 , VAL D:163 , GLY D:164 , GLU D:190 , PHE D:328 , ARG D:397 , HOH D:480 , HOH D:495BINDING SITE FOR RESIDUE TAV D 850

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1YBG)

(-) Cis Peptide Bonds  (8, 8)

Asymmetric/Biological Unit
No.Residues
1Gly A:8 -Pro A:9
2His A:299 -Pro A:300
3Gly B:8 -Pro B:9
4His B:299 -Pro B:300
5Gly C:8 -Pro C:9
6His C:299 -Pro C:300
7Gly D:8 -Pro D:9
8His D:299 -Pro D:300

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1YBG)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1YBG)

(-) Exons   (0, 0)

(no "Exon" information available for 1YBG)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:419
 aligned with MURA_ENTCC | P33038 from UniProtKB/Swiss-Prot  Length:419

    Alignment length:419
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410         
           MURA_ENTCC     1 MDKFRVQGPTRLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDIDTTMKLLTQLGTKVERNGSVWIDASNVNNFSAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGARPVDLHIFGLEKLGAEIKLEEGYVKASVNGRLKGAHIVMDKVSVGATVTIMSAATLAEGTTIIENAAREPEIVDTANFLVALGAKISGQGTDRITIEGVERLGGGVYRVLPDRIETGTFLVAAAISGGKIVCRNAQPDTLDAVLAKLREAGADIETGEDWISLDMHGKRPKAVTVRTAPHPAFPTDMQAQFTLLNLVAEGTGVITETIFENRFMHVPELIRMGAHAEIESNTVICHGVEKLSGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRALGANIERVKGE 419
               SCOP domains d1ybga_ A: UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ)                                                                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 1ybgA01           --1ybgA02 A:21-228  [code=3.65.10.10, no name defined]                                                                                                                                                            -1ybgA01 A:1-18,A:230-418  [code=3.65.10.10, no name defined]                                                                                                                                 - CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee.....eeee...hhhhhhhhhhhhhhh...eeee....hhhhhhhhhhhhh...eeee..eeeee.......eehhhhhhhhhhhhhhhhhhhhhhheeeee.....ee...hhhhhhhhhhhh..eeeee..eeeee........eee....hhhhhhhhhhhhh....eeeee....hhhhhhhhhhhhhh..eee.....eeeee.......eeee...hhhhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhh..eeee...eeeee..........eee......hhhhhhhhhhhhhh...eeeeee........hhhhhhh...eeee...eeeee........eee..hhhhhhhhhhhhhhh.eeeeee.hhhhhh...hhhhhhhh...eeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ybg A   1 MDKFRVQGPTRLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDIDTTMKLLTQLGTKVERxGSVWIDASNVNNFSAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGARPVDLHIFGLEKLGAEIKLEEGYVKASVNGRLKGAHIVMDKVSVGATVTIMSAATLAEGTTIIENAAREPEIVDTANFLVALGAKISGQGTDRITIEGVERLGGGVYRVLPDRIETGTFLVAAAISGGKIVCRNAQPDTLDAVLAKLREAGADIETGEDWISLDMHGKRPKAVTVRTAPHPAFPTDMQAQFTLLNLVAEGTGVITETIFENRFMHVPELIRMGAHAEIESNTVICHGVEKLSGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRALGANIERVKGE 419
                                    10        20        30        40        50        60      | 70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410         
                                                                                             67-IAS                                                                                                                                                                                                                                                                                                                                                            


Chain B from PDB  Type:PROTEIN  Length:419
 aligned with MURA_ENTCC | P33038 from UniProtKB/Swiss-Prot  Length:419

    Alignment length:419
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410         
           MURA_ENTCC     1 MDKFRVQGPTRLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDIDTTMKLLTQLGTKVERNGSVWIDASNVNNFSAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGARPVDLHIFGLEKLGAEIKLEEGYVKASVNGRLKGAHIVMDKVSVGATVTIMSAATLAEGTTIIENAAREPEIVDTANFLVALGAKISGQGTDRITIEGVERLGGGVYRVLPDRIETGTFLVAAAISGGKIVCRNAQPDTLDAVLAKLREAGADIETGEDWISLDMHGKRPKAVTVRTAPHPAFPTDMQAQFTLLNLVAEGTGVITETIFENRFMHVPELIRMGAHAEIESNTVICHGVEKLSGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRALGANIERVKGE 419
               SCOP domains d1ybgb_ B: UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ)                                                                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 1ybgB01           --1ybgB02 B:21-228  [code=3.65.10.10, no name defined]                                                                                                                                                            -1ybgB01 B:1-18,B:230-418  [code=3.65.10.10, no name defined]                                                                                                                                 - CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee.....eeee...hhhhhhhhhhhhhhh...eeee....hhhhhhhhhhhhh...eeee..eeeee.........hhhhhh.hhhhhhhhhhhhhhhheeeee..........hhhhhhhhhhhh..eeeee..eeeee........eee....hhhhhhhhhhhhh....eeeee....hhhhhhhhhhhhhh..eee.....eeeee.......eeee...hhhhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhh..eeee...eeeee..........eee......hhhhhhhhhhhhhh...eeeeee.......hhhhhhhhh..eeee...eeeee........eee..hhhhhhhhhhhhhhh.eeeeee.hhhhhhhh.hhhhhhhhh..eeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ybg B   1 MDKFRVQGPTRLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDIDTTMKLLTQLGTKVERxGSVWIDASNVNNFSAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGARPVDLHIFGLEKLGAEIKLEEGYVKASVNGRLKGAHIVMDKVSVGATVTIMSAATLAEGTTIIENAAREPEIVDTANFLVALGAKISGQGTDRITIEGVERLGGGVYRVLPDRIETGTFLVAAAISGGKIVCRNAQPDTLDAVLAKLREAGADIETGEDWISLDMHGKRPKAVTVRTAPHPAFPTDMQAQFTLLNLVAEGTGVITETIFENRFMHVPELIRMGAHAEIESNTVICHGVEKLSGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRALGANIERVKGE 419
                                    10        20        30        40        50        60      | 70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410         
                                                                                             67-IAS                                                                                                                                                                                                                                                                                                                                                            


Chain C from PDB  Type:PROTEIN  Length:419
 aligned with MURA_ENTCC | P33038 from UniProtKB/Swiss-Prot  Length:419

    Alignment length:419
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410         
           MURA_ENTCC     1 MDKFRVQGPTRLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDIDTTMKLLTQLGTKVERNGSVWIDASNVNNFSAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGARPVDLHIFGLEKLGAEIKLEEGYVKASVNGRLKGAHIVMDKVSVGATVTIMSAATLAEGTTIIENAAREPEIVDTANFLVALGAKISGQGTDRITIEGVERLGGGVYRVLPDRIETGTFLVAAAISGGKIVCRNAQPDTLDAVLAKLREAGADIETGEDWISLDMHGKRPKAVTVRTAPHPAFPTDMQAQFTLLNLVAEGTGVITETIFENRFMHVPELIRMGAHAEIESNTVICHGVEKLSGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRALGANIERVKGE 419
               SCOP domains d1ybgc_ C: UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ)                                                                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 1ybgC01           --1ybgC02 C:21-228  [code=3.65.10.10, no name defined]                                                                                                                                                            -1ybgC01 C:1-18,C:230-418  [code=3.65.10.10, no name defined]                                                                                                                                 - CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee.....eeee...hhhhhhhhhhhhhhh...eeee....hhhhhhhhhhhhhh..eeee..eeeee.......eehhhhhh.hhhhhhhhhhhhhhhheeeee...........hhhhhhhhhhh..eeeee..eeeee........eeee...hhhhhhhhhhhhh....eeeee....hhhhhhhhhhhhhh..eee......eeee.......eeee...hhhhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhh..eeee...eeeee..........eee......hhhhhhhhhhhhhh...eeeeee.......hhhhhhhh...eeee...eeeee........eee..hhhhhhhhhhhhhhh.eeeeee.hhhhhh...hhhhhhhhh..eeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ybg C   1 MDKFRVQGPTRLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDIDTTMKLLTQLGTKVERxGSVWIDASNVNNFSAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGARPVDLHIFGLEKLGAEIKLEEGYVKASVNGRLKGAHIVMDKVSVGATVTIMSAATLAEGTTIIENAAREPEIVDTANFLVALGAKISGQGTDRITIEGVERLGGGVYRVLPDRIETGTFLVAAAISGGKIVCRNAQPDTLDAVLAKLREAGADIETGEDWISLDMHGKRPKAVTVRTAPHPAFPTDMQAQFTLLNLVAEGTGVITETIFENRFMHVPELIRMGAHAEIESNTVICHGVEKLSGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRALGANIERVKGE 419
                                    10        20        30        40        50        60      | 70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410         
                                                                                             67-IAS                                                                                                                                                                                                                                                                                                                                                            


Chain D from PDB  Type:PROTEIN  Length:419
 aligned with MURA_ENTCC | P33038 from UniProtKB/Swiss-Prot  Length:419

    Alignment length:419
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410         
           MURA_ENTCC     1 MDKFRVQGPTRLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDIDTTMKLLTQLGTKVERNGSVWIDASNVNNFSAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGARPVDLHIFGLEKLGAEIKLEEGYVKASVNGRLKGAHIVMDKVSVGATVTIMSAATLAEGTTIIENAAREPEIVDTANFLVALGAKISGQGTDRITIEGVERLGGGVYRVLPDRIETGTFLVAAAISGGKIVCRNAQPDTLDAVLAKLREAGADIETGEDWISLDMHGKRPKAVTVRTAPHPAFPTDMQAQFTLLNLVAEGTGVITETIFENRFMHVPELIRMGAHAEIESNTVICHGVEKLSGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRALGANIERVKGE 419
               SCOP domains d1ybgd_ D: UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ)                                                                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 1ybgD01           --1ybgD02 D:21-228  [code=3.65.10.10, no name defined]                                                                                                                                                            -1ybgD01 D:1-18,D:230-418  [code=3.65.10.10, no name defined]                                                                                                                                 - CATH domains
           Pfam domains (1) -----EPSP_synthase-1ybgD01 D:6-406                                                                                                                                                                                                                                                                                                                                                                                    ------------- Pfam domains (1)
           Pfam domains (2) -----EPSP_synthase-1ybgD02 D:6-406                                                                                                                                                                                                                                                                                                                                                                                    ------------- Pfam domains (2)
           Pfam domains (3) -----EPSP_synthase-1ybgD03 D:6-406                                                                                                                                                                                                                                                                                                                                                                                    ------------- Pfam domains (3)
           Pfam domains (4) -----EPSP_synthase-1ybgD04 D:6-406                                                                                                                                                                                                                                                                                                                                                                                    ------------- Pfam domains (4)
         Sec.struct. author ..eeeeee.....eeee...hhhhhhhhhhhhhhh...eeee....hhhhhhhhhhhhhh..eeee...eeee.......eehhhhhh.hhhhhhhhhhhhhhhheeeee..........hhhhhhhhhhhh..eeeee..eeeee........eee....hhhhhhhhhhhhh....eeeee....hhhhhhhhhhhhhh..eee.....eeeee.......eeee...hhhhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhh..eeee...eeeee..........ee.......hhhhhhhhhhhhhh...eeeee.........hhhhhhh...eeee...eeeee........eee..hhhhhhhhhhhhhhh.eeeeee.hhhhhhhh.hhhhhhhh...eeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ybg D   1 MDKFRVQGPTRLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDIDTTMKLLTQLGTKVERxGSVWIDASNVNNFSAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGARPVDLHIFGLEKLGAEIKLEEGYVKASVNGRLKGAHIVMDKVSVGATVTIMSAATLAEGTTIIENAAREPEIVDTANFLVALGAKISGQGTDRITIEGVERLGGGVYRVLPDRIETGTFLVAAAISGGKIVCRNAQPDTLDAVLAKLREAGADIETGEDWISLDMHGKRPKAVTVRTAPHPAFPTDMQAQFTLLNLVAEGTGVITETIFENRFMHVPELIRMGAHAEIESNTVICHGVEKLSGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRALGANIERVKGE 419
                                    10        20        30        40        50        60      | 70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410         
                                                                                             67-IAS
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 8)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Clan: EPT_RTPC (43)

(-) Gene Ontology  (11, 11)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (MURA_ENTCC | P33038)
molecular function
    GO:0008760    UDP-N-acetylglucosamine 1-carboxyvinyltransferase activity    Catalysis of the reaction: phosphoenolpyruvate + UDP-N-acetyl-alpha-D-glucosamine = phosphate + UDP-N-acetyl-3-O-(1-carboxyvinyl)-D-glucosamine.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016765    transferase activity, transferring alkyl or aryl (other than methyl) groups    Catalysis of the transfer of an alkyl or aryl (but not methyl) group from one compound (donor) to another (acceptor).
biological process
    GO:0019277    UDP-N-acetylgalactosamine biosynthetic process    The chemical reactions and pathways resulting in the formation of UDP-N-acetylgalactosamine, a substance composed of N-acetylgalactosamine, a common structural unit of oligosaccharides, in glycosidic linkage with uridine diphosphate.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0051301    cell division    The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
    GO:0071555    cell wall organization    A process that results in the assembly, arrangement of constituent parts, or disassembly of the cell wall, the rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal and most prokaryotic cells, maintaining their shape and protecting them from osmotic lysis.
    GO:0009252    peptidoglycan biosynthetic process    The chemical reactions and pathways resulting in the formation of peptidoglycans, any of a class of glycoconjugates found in bacterial cell walls.
    GO:0008360    regulation of cell shape    Any process that modulates the surface configuration of a cell.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    IAS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TAV  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:8 - Pro A:9   [ RasMol ]  
    Gly B:8 - Pro B:9   [ RasMol ]  
    Gly C:8 - Pro C:9   [ RasMol ]  
    Gly D:8 - Pro D:9   [ RasMol ]  
    His A:299 - Pro A:300   [ RasMol ]  
    His B:299 - Pro B:300   [ RasMol ]  
    His C:299 - Pro C:300   [ RasMol ]  
    His D:299 - Pro D:300   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ybg
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MURA_ENTCC | P33038
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.5.1.7
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  MURA_ENTCC | P33038
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MURA_ENTCC | P33038: 1dlg 1ejc 1ejd 1eyn 1naw 1q3g 1ryw 3kqa 3lth 3spb 3su9 3swa 3swi 3swq 3upk 3v4t 3v5v 4e7b 4e7c 4e7d 4e7e 4e7f 4e7g 4eii

(-) Related Entries Specified in the PDB File

1ejc 1ejd 1eyn 1naw 1q3g 1uae