Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  BORDETELLA FERRIC BINDING PROTEIN
 
Authors :  S. A. L. Tom-Yew, D. T. Cui, E. G. Bekker, M. E. P. Murphy
Date :  16 Dec 04  (Deposition) - 11 Jan 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.39
Chains :  Asym./Biol. Unit :  A
Keywords :  Periplasmic Binding Protein, Iron Tyrosinate Interaction, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. A. L. Tom-Yew, D. T. Cui, E. G. Bekker, M. E. P. Murphy
Anion-Independent Iron Coordination By The Campylobacter Jejuni Ferric Binding Protein
J. Biol. Chem. V. 280 9283 2005
PubMed-ID: 15613474  |  Reference-DOI: 10.1074/JBC.M412479200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PUTATIVE IRON BINDING PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET28A
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Organism Scientific: BORDETELLA PERTUSSIS TOHAMA I
    Organism Taxid: 257313
    Strain: TOHAMA I

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1Y9U)

(-) Sites  (0, 0)

(no "Site" information available for 1Y9U)

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:135 -A:191

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1Y9U)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1Y9U)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1Y9U)

(-) Exons   (0, 0)

(no "Exon" information available for 1Y9U)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:314
 aligned with Q7VXW9_BORPE | Q7VXW9 from UniProtKB/TrEMBL  Length:349

    Alignment length:318
                                    41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341        
         Q7VXW9_BORPE    32 DEVSLYTTREPKLIQPLLDAFAKDSGIKVNTVFVKDGLLERVRAEGDKSPADVLMTVDIGNLIDLVNGGVTQKIQSQTLDSVVPANLRGAEGSWYALSLRDRVLYVEKDLKLDSFRYGDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGAEATEKWLRGVKANLARKAAGGDRDVARDILGGICDIGLANAYYVGHMKNAEPGTDARKWGDAIKVVRPTFATAKDGGTHVNISGAAVAAHAPNKANAVKLLEYLVSEPAQTLYAQANYEYPVRAGVKLDAVVASFGPLKVDTLPVAEIAKYRKQASELVDKVGFDN 349
               SCOP domains d1y9ua_ A: Ferric-binding protein FbpA                                                                                                                                                                                                                                                                                         SCOP domains
               CATH domains 1y9uA01 A:6-102,A:234-283 Periplasmic binding protein-like II                                    1y9uA02 A:103-233,A:284-323 Periplasmic binding protein-like II                                                                    1y9uA01 A:6-102,A:234-283                         1y9uA02 A:103-233,A:284-323              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee..hhhhhhhhhhhhhhhhh.eeeeee...hhhhhhhhhhhhh...eeeeehhhhhhhhhhh..ee...hhhhhhhhhhhhhhhhhh.eeeeeeeeeeeee........hhhhhhhhhhh..ee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh....eeeeehhhhhhhhhh...hhhhhhhhheeee.....----....eeeeeeeee....hhhhhhhhhhhhhhhhhhhhhhhhh..ee.......hhhhhhh.........hhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1y9u A   6 DEVSLYTTREPKLIQPLLDAFAKDSGIKVNTVFVKDGLLERVRAEGDKSPADVLMTVDIGNLIDLVNGGVTQKIQSQTLDSVVPANLRGAEGSWYALSLRDRVLYVEKDLKLDSFRYGDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGAEATEKWLRGVKANLARKAAGGDRDVARDILGGICDIGLANAYYVGHMKNAEPGTDARKWGDAIKVVRPTFA----GGTHVNISGAAVAAHAPNKANAVKLLEYLVSEPAQTLYAQANYEYPVRAGVKLDAVVASFGPLKVDTLPVAEIAKYRKQASELVDKVGFDN 323
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225  |    235       245       255       265       275       285       295       305       315        
                                                                                                                                                                                                                                                        228  233
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1Y9U)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q7VXW9_BORPE | Q7VXW9)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1y9u)
 
  Sites
(no "Sites" information available for 1y9u)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1y9u)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1y9u
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q7VXW9_BORPE | Q7VXW9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q7VXW9_BORPE | Q7VXW9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q7VXW9_BORPE | Q7VXW9: 2ows 2owt

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1Y9U)