Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CYCLOPHILIN FROM TRYPANOSOMA CRUZI
 
Authors :  J. M. Caruthers, W. G. J. Hol, Structural Genomics Of Pathogenic Pr Consortium (Sgpp)
Date :  05 Oct 04  (Deposition) - 21 Dec 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.61
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Cyclophilin, Rotamase, Proline, Isomerase, Cis-Trans, Trypanosoma, Cruzi, Structural Genomics, Protein Structure Initiative, Psi, Structural Genomics Of Pathogenic Protozoa Consortium, Sgpp (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. M. Caruthers, W. G. J. Hol, Structural Genomics Of Pathogenic Protozoa Consortium (Sgpp
Crystal Structure Of Cyclophilin From Trypanosoma Cruzi
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - CYCLOPHILIN
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidBG1861
    Expression System StrainBL21-STAR
    Expression System Taxid562
    Expression System Vector TypePLASMID
    Organism ScientificTRYPANOSOMA CRUZI
    Organism Taxid5693

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A   
Biological Unit 2 (1x) B  
Biological Unit 3 (1x)  C 
Biological Unit 4 (1x)   D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1XO7)

(-) Sites  (0, 0)

(no "Site" information available for 1XO7)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1XO7)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1XO7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1XO7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1XO7)

(-) Exons   (0, 0)

(no "Exon" information available for 1XO7)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:166
 aligned with Q4DPB9_TRYCC | Q4DPB9 from UniProtKB/TrEMBL  Length:194

    Alignment length:166
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188      
         Q4DPB9_TRYCC    29 DPVVTDKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLASGENGFGYKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKHFVGAVSMANAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGVL 194
               SCOP domains d1xo7a_ A: Cyclophilin (eukaryotic)                                                                                                                                    SCOP domains
               CATH domains 1xo7A00 A:1-166 Cyclophilin                                                                                                                                            CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeee..eeeeeeeeee....hhhhhhhhhhhhhh..........eeeee...eeee...............................eeee...........eeee...hhhhh....eeeeeeehhhhhhhhhh...hhhhh....eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xo7 A   1 MPVVTDKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLASGENGFGYKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKHFVGAVSMANAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGVL 166
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160      

Chain B from PDB  Type:PROTEIN  Length:166
 aligned with Q4DPB9_TRYCC | Q4DPB9 from UniProtKB/TrEMBL  Length:194

    Alignment length:166
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188      
         Q4DPB9_TRYCC    29 DPVVTDKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLASGENGFGYKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKHFVGAVSMANAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGVL 194
               SCOP domains d1xo7b_ B: Cyclophilin (eukaryotic)                                                                                                                                    SCOP domains
               CATH domains 1xo7B00 B:1-166 Cyclophilin                                                                                                                                            CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeee..eeeeeeeeee....hhhhhhhhhhhhhh..........eeeee...eeee...............................eeee...........eeee...hhhhh....eeeeeeehhhhhhhhhh...hhhhh....eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xo7 B   1 MPVVTDKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLASGENGFGYKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKHFVGAVSMANAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGVL 166
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160      

Chain C from PDB  Type:PROTEIN  Length:166
 aligned with Q4DPB9_TRYCC | Q4DPB9 from UniProtKB/TrEMBL  Length:194

    Alignment length:166
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188      
         Q4DPB9_TRYCC    29 DPVVTDKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLASGENGFGYKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKHFVGAVSMANAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGVL 194
               SCOP domains d1xo7c_ C: Cyclophilin (eukaryotic)                                                                                                                                    SCOP domains
               CATH domains 1xo7C00 C:1-166 Cyclophilin                                                                                                                                            CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeee..eeeeeeeeee....hhhhhhhhhhhhhh............eee...eeee...............................eeee...........eeee...hhhhh....eeeeeeehhhhhhhhhh...hhhhh....eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xo7 C   1 MPVVTDKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLASGENGFGYKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKHFVGAVSMANAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGVL 166
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160      

Chain D from PDB  Type:PROTEIN  Length:166
 aligned with Q4DPB9_TRYCC | Q4DPB9 from UniProtKB/TrEMBL  Length:194

    Alignment length:166
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188      
         Q4DPB9_TRYCC    29 DPVVTDKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLASGENGFGYKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKHFVGAVSMANAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGVL 194
               SCOP domains d1xo7d_ D: Cyclophilin (eukaryotic)                                                                                                                                    SCOP domains
               CATH domains 1xo7D00 D:1-166 Cyclophilin                                                                                                                                            CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeee..eeeeeeeeee....hhhhhhhhhhhhhh..........eeeee...eeee...............................eeee...........eeee...hhhhh....eeeeeeehhhhhhhhhh...hhhhh....eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xo7 D   1 MPVVTDKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLASGENGFGYKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKHFVGAVSMANAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGVL 166
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1XO7)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (Q4DPB9_TRYCC | Q4DPB9)
molecular function
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0003755    peptidyl-prolyl cis-trans isomerase activity    Catalysis of the reaction: peptidyl-proline (omega=180) = peptidyl-proline (omega=0).
biological process
    GO:0006457    protein folding    The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
    GO:0000413    protein peptidyl-prolyl isomerization    The modification of a protein by cis-trans isomerization of a proline residue.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1xo7)
 
  Sites
(no "Sites" information available for 1xo7)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1xo7)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1xo7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q4DPB9_TRYCC | Q4DPB9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q4DPB9_TRYCC | Q4DPB9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q4DPB9_TRYCC | Q4DPB91xq7

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1XO7)