|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 3)
Asymmetric Unit (1, 3)
|
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1XLQ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1XLQ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1XLQ) |
PROSITE Motifs (2, 6)
Asymmetric Unit (2, 6)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1XLQ) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:106 aligned with PUTX_PSEPU | P00259 from UniProtKB/Swiss-Prot Length:107 Alignment length:106 11 21 31 41 51 61 71 81 91 101 PUTX_PSEPU 2 SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW 107 SCOP domains d1xlqa_ A: 2Fe-2S ferredoxin SCOP domains CATH domains 1xlqA00 A:1-106 [code=3.10.20.30, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) 2FE2S_FER_2 PDB: A:1-105 UniProt: 2-106 - PROSITE (1) PROSITE (2) --------------------------------------ADX --------------------------------------------------------- PROSITE (2) Transcript ---------------------------------------------------------------------------------------------------------- Transcript 1xlq A 1 SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW 106 10 20 30 40 50 60 70 80 90 100 Chain B from PDB Type:PROTEIN Length:106 aligned with PUTX_PSEPU | P00259 from UniProtKB/Swiss-Prot Length:107 Alignment length:106 11 21 31 41 51 61 71 81 91 101 PUTX_PSEPU 2 SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW 107 SCOP domains d1xlqb_ B: 2Fe-2S ferredoxin SCOP domains CATH domains 1xlqB00 B:1-106 [code=3.10.20.30, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) 2FE2S_FER_2 PDB: B:1-105 UniProt: 2-106 - PROSITE (1) PROSITE (2) --------------------------------------ADX --------------------------------------------------------- PROSITE (2) Transcript ---------------------------------------------------------------------------------------------------------- Transcript 1xlq B 1 SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW 106 10 20 30 40 50 60 70 80 90 100 Chain C from PDB Type:PROTEIN Length:106 aligned with PUTX_PSEPU | P00259 from UniProtKB/Swiss-Prot Length:107 Alignment length:106 11 21 31 41 51 61 71 81 91 101 PUTX_PSEPU 2 SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW 107 SCOP domains d1xlqc_ C: 2Fe-2S ferredoxin SCOP domains CATH domains 1xlqC00 C:1-106 [code=3.10.20.30, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) 2FE2S_FER_2 PDB: C:1-105 UniProt: 2-106 - PROSITE (1) PROSITE (2) --------------------------------------ADX --------------------------------------------------------- PROSITE (2) Transcript ---------------------------------------------------------------------------------------------------------- Transcript 1xlq C 1 SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW 106 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (1, 3)| Asymmetric Unit |
CATH Domains (1, 3)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1XLQ) |
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A,B,C (PUTX_PSEPU | P00259)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|