1XK5 - JenaLib

Title :   CRYSTAL STRUCTURE OF THE M3G-CAP-BINDING DOMAIN OF SNURPORTIN1 IN COMPLEX WITH A M3GPPPG-CAP DINUCLEOTIDE

Authors :   A. Strasser, A. Dickmanns, R. Luehrmann, R. Ficner

Date :   27 Sep 04 (Deposition) - 07 Jun 05 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.40

Chains :   Asym./Biol. Unit : A

Keywords :   Protein-Rna-Complex, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. Strasser, A. Dickmanns, R. Luehrmann, R. Ficner
Structural Basis For M(3)G-Cap-Mediated Nuclear Import Of Spliceosomal Usnrnps By Snurportin1
Embo J. V. 24 2235 2005
PubMed-ID: 15920472 | Reference-DOI: 10.1038/SJ.EMBOJ.7600701
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (7, 7)

Asymmetric/Biological Unit (7, 7)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000308588	1b	ENSE00001328747	chr15:75918156-75918007	150	SPN1_HUMAN	-	0	0	-	-
1.3b	ENST00000308588	3b	ENSE00001690493	chr15:75913397-75913235	163	SPN1_HUMAN	1-53	53	0	-	-
1.4	ENST00000308588	4	ENSE00001208446	chr15:75909893-75909749	145	SPN1_HUMAN	53-101	49	1	A:97-101	5
1.5	ENST00000308588	5	ENSE00001295612	chr15:75902335-75902231	105	SPN1_HUMAN	102-136	35	1	A:102-136	35
1.6	ENST00000308588	6	ENSE00001310397	chr15:75901992-75901899	94	SPN1_HUMAN	137-168	32	1	A:137-168	32
1.7	ENST00000308588	7	ENSE00001311880	chr15:75899654-75899557	98	SPN1_HUMAN	168-200	33	1	A:168-200	33
1.8	ENST00000308588	8	ENSE00001208428	chr15:75897568-75897491	78	SPN1_HUMAN	201-226	26	1	A:201-226	26
1.9	ENST00000308588	9	ENSE00001161530	chr15:75893559-75893479	81	SPN1_HUMAN	227-253	27	1	A:227-253	27
1.10	ENST00000308588	10	ENSE00001295764	chr15:75891022-75890424	599	SPN1_HUMAN	254-360	107	1	A:254-300	47

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:204
 aligned with SPN1_HUMAN | O95149 from UniProtKB/Swiss-Prot  Length:360

    Alignment length:204
                                   106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296    
           SPN1_HUMAN    97 HYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRNSTAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGVAVPAGPLTTKPD 300
               SCOP domains d1xk5a_ A: m3G-cap binding domain of snurportin-1                                                                                                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......eeeee......hhhhheeeeeee..eeeeeeee..eeeee.....eeeee.................eeeeeeeehhh.eeeeeeeeee..ee....hhhhhhhhhhhhh...............eeee..eee.hhhhhhhhhh......eeeeeeee.......eeeeeeeeehhhhhhhhhh.....hhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) 1.4  Exon 1.5  PDB: A:102-136           Exon 1.6  PDB: A:137-168        --------------------------------Exon 1.8  PDB: A:201-226  Exon 1.9  PDB: A:227-253   Exon 1.10  PDB: A:254-300 UniProt: 254-360      Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------Exon 1.7  PDB: A:168-200         ---------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1xk5 A  97 HYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRNSTAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGVAVPAGPLTTKPD 300
                                   106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (13, 13)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (SPN1_HUMAN | O95149)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0000339	RNA cap binding	Interacting selectively and non-covalently with a 7-methylguanosine (m7G) group or derivative located at the 5' end of an RNA molecule.
	GO:0008565	protein transporter activity	Enables the directed movement of proteins into, out of or within a cell, or between cells.
biological process
	GO:0051170	nuclear import	The directed movement of substances into the nucleus.
	GO:0006606	protein import into nucleus	The directed movement of a protein from the cytoplasm to the nucleus.
	GO:0061015	snRNA import into nucleus	The directed movement of snRNA, small nuclear ribonucleic acid into the nucleus.
	GO:0000387	spliceosomal snRNP assembly	The aggregation, arrangement and bonding together of one or more snRNA and multiple protein components to form a ribonucleoprotein complex that is involved in formation of the spliceosome.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005643	nuclear pore	Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		TPG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1xk5)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1xk5
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SPN1_HUMAN \| O95149
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description