Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF LPDA (RV3303C) FROM MYCOBACTERIUM TUBERCULOSIS
 
Authors :  A. Argyrou, M. W. Vetting, J. S. Blanchard
Date :  06 Sep 04  (Deposition) - 19 Oct 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.81
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Biol. Unit 2:  A,B  (1x)
Keywords :  Mycobacterium Tuberculosis, Reductase, Fad, Nad, Nadp, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Argyrou, M. W. Vetting, J. S. Blanchard
Characterization Of A New Member Of The Flavoprotein Disulfide Reductase Family Of Enzymes From Mycobacterium Tuberculosis
J. Biol. Chem. V. 279 52694 2004
PubMed-ID: 15456792  |  Reference-DOI: 10.1074/JBC.M410704200

(-) Compounds

Molecule 1 - RV3303C-LPDA
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET23A(+)
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: RV3303C - LPDA
    Organism Scientific: MYCOBACTERIUM TUBERCULOSIS
    Organism Taxid: 1773

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (2x): AB
Biological Unit 2 (1x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1FAD2Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
Biological Unit 1 (1, 4)
No.NameCountTypeFull Name
1FAD4Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1FAD2Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:9 , GLY A:10 , GLY A:11 , PRO A:12 , ALA A:13 , ILE A:34 , ASP A:35 , CYS A:36 , ASP A:37 , GLY A:41 , ALA A:42 , ALA A:43 , ASP A:47 , CYS A:48 , SER A:51 , LYS A:52 , GLY A:115 , ARG A:116 , GLY A:117 , ALA A:151 , THR A:152 , GLY A:153 , TRP A:172 , LEU A:284 , GLY A:316 , ASP A:317 , PRO A:323 , LEU A:324 , ALA A:325 , SER A:326 , PHE A:357 , HOH A:1015 , HOH A:1021 , TYR B:450 , HOH B:1049BINDING SITE FOR RESIDUE FAD A 999
2AC2SOFTWARETYR A:450 , GLY B:9 , GLY B:11 , PRO B:12 , ALA B:13 , ILE B:34 , ASP B:35 , CYS B:36 , ASP B:37 , GLY B:41 , ALA B:42 , ALA B:43 , ASP B:47 , CYS B:48 , SER B:51 , LYS B:52 , ARG B:116 , GLY B:117 , ALA B:151 , THR B:152 , GLY B:153 , TRP B:172 , LEU B:284 , GLY B:316 , ASP B:317 , PRO B:323 , LEU B:324 , ALA B:325 , SER B:326 , PHE B:357 , HOH B:1024 , HOH B:1027BINDING SITE FOR RESIDUE FAD B 999

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1XDI)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Arg A:359 -Pro A:360
2Tyr A:450 -Pro A:451
3Arg B:359 -Pro B:360
4Tyr B:450 -Pro B:451

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1XDI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1XDI)

(-) Exons   (0, 0)

(no "Exon" information available for 1XDI)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:459
 aligned with LPDA_MYCTO | P9WHH6 from UniProtKB/Swiss-Prot  Length:493

    Alignment length:465
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461     
           LPDA_MYCTO     2 VTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGLRTELRRAPHLGFHIDFDDAKISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRLFKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRPEIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMA 466
               SCOP domains d1xdia1 A:2-161,A:276-348 Dihydrolipoamide dehydrogenase                                                                                                        ------------------------------------------------------------------------------------------------------------------d1xdia1 A:2-161,A:276-348 Dihydrolipoamide dehydrogenase                 d1xdia2 A:349-466 Dihydrolipoamide dehydrogenase                                                                       SCOP domains
               CATH domains 1xdiA01 A:2-156,A:276-344  [code=3.50.50.60, no name defined]                                                                                              1xdiA02 A:157-275  [code=3.50.50.60, no name defined]                                                                  1xdiA01 A:2-156,A:276-344  [code=3.50.50.60, no name defined]        1xdiA03 A:345-466  [code=3.30.390.30, no name defined]                                                                     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee..hhhhhhhhhhhhhhh...eeeeeee....hhhhhhhhhhhhhhhhhhhhhhhhhh........------..hhhhhhhhhhhhhhhhhhhhhhhhhhh..eeee.eeee.........eeeeee.....eeeeee.eeee...eee..hhhhh.....eee.hhhhhh......eeee..hhhhhhhhhhhhhh...eeee..........hhhhhhhhhhhhhhh..eee....eeeeee....eeeee....eeee.eeee...eee................................eee.hhhhh...hhhhhhhhhhhhhhhhh.......hhhh.eeee....eeeeee.hhhhhhh....eeeeeee...hhhhhhh.....eeeeeee.....eeeeeeee.hhhhhhhhhhhhhhhh.hhhhhhh.......hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xdi A   2 VTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGLRTELRRAPHLGFH------KISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRLFKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRPEIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMA 466
                                    11        21        31        41        51        61        71 |      81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461     
                                                                                                  73     80                                                                                                                                                                                                                                                                                                                                                                                                  


Chain A from PDB  Type:PROTEIN  Length:459
 aligned with LPDA_MYCTU | P9WHH7 from UniProtKB/Swiss-Prot  Length:493

    Alignment length:465
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461     
           LPDA_MYCTU     2 VTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGLRTELRRAPHLGFHIDFDDAKISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRLFKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRPEIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMA 466
               SCOP domains d1xdia1 A:2-161,A:276-348 Dihydrolipoamide dehydrogenase                                                                                                        ------------------------------------------------------------------------------------------------------------------d1xdia1 A:2-161,A:276-348 Dihydrolipoamide dehydrogenase                 d1xdia2 A:349-466 Dihydrolipoamide dehydrogenase                                                                       SCOP domains
               CATH domains 1xdiA01 A:2-156,A:276-344  [code=3.50.50.60, no name defined]                                                                                              1xdiA02 A:157-275  [code=3.50.50.60, no name defined]                                                                  1xdiA01 A:2-156,A:276-344  [code=3.50.50.60, no name defined]        1xdiA03 A:345-466  [code=3.30.390.30, no name defined]                                                                     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee..hhhhhhhhhhhhhhh...eeeeeee....hhhhhhhhhhhhhhhhhhhhhhhhhh........------..hhhhhhhhhhhhhhhhhhhhhhhhhhh..eeee.eeee.........eeeeee.....eeeeee.eeee...eee..hhhhh.....eee.hhhhhh......eeee..hhhhhhhhhhhhhh...eeee..........hhhhhhhhhhhhhhh..eee....eeeeee....eeeee....eeee.eeee...eee................................eee.hhhhh...hhhhhhhhhhhhhhhhh.......hhhh.eeee....eeeeee.hhhhhhh....eeeeeee...hhhhhhh.....eeeeeee.....eeeeeeee.hhhhhhhhhhhhhhhh.hhhhhhh.......hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xdi A   2 VTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGLRTELRRAPHLGFH------KISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRLFKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRPEIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMA 466
                                    11        21        31        41        51        61        71 |      81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461     
                                                                                                  73     80                                                                                                                                                                                                                                                                                                                                                                                                  


Chain B from PDB  Type:PROTEIN  Length:459
 aligned with LPDA_MYCTO | P9WHH6 from UniProtKB/Swiss-Prot  Length:493

    Alignment length:465
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461     
           LPDA_MYCTO     2 VTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGLRTELRRAPHLGFHIDFDDAKISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRLFKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRPEIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMA 466
               SCOP domains d1xdib1 B:2-161,B:276-348 Dihydrolipoamide dehydrogenase                                                                                                        ------------------------------------------------------------------------------------------------------------------d1xdib1 B:2-161,B:276-348 Dihydrolipoamide dehydrogenase                 d1xdib2 B:349-466 Dihydrolipoamide dehydrogenase                                                                       SCOP domains
               CATH domains 1xdiB01 B:2-156,B:276-344  [code=3.50.50.60, no name defined]                                                                                              1xdiB02 B:157-275  [code=3.50.50.60, no name defined]                                                                  1xdiB01 B:2-156,B:276-344  [code=3.50.50.60, no name defined]        1xdiB03 B:345-466  [code=3.30.390.30, no name defined]                                                                     CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Pyr_redox-1xdiB01 B:184-264                                                      ---------------------------------------------------------------------------------------Pyr_redox_dim-1xdiB05 B:352-461                                                                               ----- Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Pyr_redox-1xdiB02 B:184-264                                                      ---------------------------------------------------------------------------------------Pyr_redox_dim-1xdiB06 B:352-461                                                                               ----- Pfam domains (2)
           Pfam domains (3) --Pyr_redox_2-1xdiB03 B:4-322                                                                                                                                                                                                                                                                                                    ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains (3)
           Pfam domains (4) --Pyr_redox_2-1xdiB04 B:4-322                                                                                                                                                                                                                                                                                                    ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains (4)
         Sec.struct. author .eeeeee..hhhhhhhhhhhhhhh...eeeeeee....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..------..hhhhhhhhhhhhhhhhhhhhhhhhhh...eeee.eeee.........eeeeee.....eeeeee.eeee...eee............eee..hhhhh......eeee.hhhhhhhhhhhhhhh...eeee..........hhhhhhhhhhhhhh...eee....eeeeee....eeeee....eeee.eeee...eee.....hhhhhh...hhhhh.............eee.hhhhh...hhhhhhhhhhhhhhhhh.......hhhhh.eee....eeeeee.hhhhhh......eeeeee...hhhhhhh.....eeeeee......eeeeeeee.hhhhhhhhhhhhhhh..hhhhhh.........hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xdi B   2 VTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGLRTELRRAPHLGFH------KISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRLFKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRPEIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMA 466
                                    11        21        31        41        51        61        71 |      81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461     
                                                                                                  73     80                                                                                                                                                                                                                                                                                                                                                                                                  


Chain B from PDB  Type:PROTEIN  Length:459
 aligned with LPDA_MYCTU | P9WHH7 from UniProtKB/Swiss-Prot  Length:493

    Alignment length:465
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461     
           LPDA_MYCTU     2 VTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGLRTELRRAPHLGFHIDFDDAKISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRLFKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRPEIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMA 466
               SCOP domains d1xdib1 B:2-161,B:276-348 Dihydrolipoamide dehydrogenase                                                                                                        ------------------------------------------------------------------------------------------------------------------d1xdib1 B:2-161,B:276-348 Dihydrolipoamide dehydrogenase                 d1xdib2 B:349-466 Dihydrolipoamide dehydrogenase                                                                       SCOP domains
               CATH domains 1xdiB01 B:2-156,B:276-344  [code=3.50.50.60, no name defined]                                                                                              1xdiB02 B:157-275  [code=3.50.50.60, no name defined]                                                                  1xdiB01 B:2-156,B:276-344  [code=3.50.50.60, no name defined]        1xdiB03 B:345-466  [code=3.30.390.30, no name defined]                                                                     CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Pyr_redox-1xdiB01 B:184-264                                                      ---------------------------------------------------------------------------------------Pyr_redox_dim-1xdiB05 B:352-461                                                                               ----- Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Pyr_redox-1xdiB02 B:184-264                                                      ---------------------------------------------------------------------------------------Pyr_redox_dim-1xdiB06 B:352-461                                                                               ----- Pfam domains (2)
           Pfam domains (3) --Pyr_redox_2-1xdiB03 B:4-322                                                                                                                                                                                                                                                                                                    ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains (3)
           Pfam domains (4) --Pyr_redox_2-1xdiB04 B:4-322                                                                                                                                                                                                                                                                                                    ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains (4)
         Sec.struct. author .eeeeee..hhhhhhhhhhhhhhh...eeeeeee....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..------..hhhhhhhhhhhhhhhhhhhhhhhhhh...eeee.eeee.........eeeeee.....eeeeee.eeee...eee............eee..hhhhh......eeee.hhhhhhhhhhhhhhh...eeee..........hhhhhhhhhhhhhh...eee....eeeeee....eeeee....eeee.eeee...eee.....hhhhhh...hhhhh.............eee.hhhhh...hhhhhhhhhhhhhhhhh.......hhhhh.eee....eeeeee.hhhhhh......eeeeee...hhhhhhh.....eeeeee......eeeeeeee.hhhhhhhhhhhhhhh..hhhhhh.........hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xdi B   2 VTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGLRTELRRAPHLGFH------KISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRLFKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRPEIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMA 466
                                    11        21        31        41        51        61        71 |      81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461     
                                                                                                  73     80
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (2, 6)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (3, 6)

Asymmetric Unit
(-)
Clan: NADP_Rossmann (1239)
(-)
Clan: no clan defined [family: Pyr_redox_dim] (44)

(-) Gene Ontology  (10, 16)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (LPDA_MYCTU | P9WHH7)
molecular function
    GO:0003955    NAD(P)H dehydrogenase (quinone) activity    Catalysis of the reaction: NAD(P)H + H+ + a quinone = NAD(P)+ + a hydroquinone.
    GO:0070401    NADP+ binding    Interacting selectively and non-covalently with the oxidized form, NADP+, of nicotinamide-adenine dinucleotide phosphate, a coenzyme involved in many redox and biosynthetic reactions.
    GO:0050660    flavin adenine dinucleotide binding    Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016655    oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor    Catalysis of an oxidation-reduction (redox) reaction in which NADH or NADPH acts as a hydrogen or electron donor and reduces a quinone or a similar acceptor molecule.
    GO:0016668    oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor    Catalysis of an oxidation-reduction (redox) reaction in which a sulfur-containing group acts as a hydrogen or electron donor and reduces NAD or NADP.
biological process
    GO:0045454    cell redox homeostasis    Any process that maintains the redox environment of a cell or compartment within a cell.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005623    cell    The basic structural and functional unit of all organisms. Includes the plasma membrane and any external encapsulating structures such as the cell wall and cell envelope.

Chain A,B   (LPDA_MYCTO | P9WHH6)
molecular function
    GO:0003955    NAD(P)H dehydrogenase (quinone) activity    Catalysis of the reaction: NAD(P)H + H+ + a quinone = NAD(P)+ + a hydroquinone.
    GO:0050660    flavin adenine dinucleotide binding    Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0045454    cell redox homeostasis    Any process that maintains the redox environment of a cell or compartment within a cell.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0005623    cell    The basic structural and functional unit of all organisms. Includes the plasma membrane and any external encapsulating structures such as the cell wall and cell envelope.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg A:359 - Pro A:360   [ RasMol ]  
    Arg B:359 - Pro B:360   [ RasMol ]  
    Tyr A:450 - Pro A:451   [ RasMol ]  
    Tyr B:450 - Pro B:451   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1xdi
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LPDA_MYCTO | P9WHH6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  LPDA_MYCTU | P9WHH7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  LPDA_MYCTO | P9WHH6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  LPDA_MYCTU | P9WHH7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1XDI)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1XDI)