|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (1, 24)
|
Asymmetric Unit (24, 24)
|
(no "SS Bond" information available for 1XB0) |
(no "Cis Peptide Bond" information available for 1XB0) |
(no "SAP(SNP)/Variant" information available for 1XB0) |
Asymmetric/Biological Unit (2, 12)
|
(no "Exon" information available for 1XB0) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:92 aligned with BIRC8_HUMAN | Q96P09 from UniProtKB/Swiss-Prot Length:236 Alignment length:92 1 |2 12 22 32 42 52 62 72 82 BIRC8_HUMAN - --------MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLT 84 SCOP domains d1xb0a_ A: BIR-containing protein 8 SCOP domains CATH domains 1xb0A00 A:254-345 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains -------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------BIR_REPEAT_1 PDB: A:265-330 UniProt: 4-69 --------------- PROSITE (1) PROSITE (2) --------------BIR_REPEAT_2 PDB: A:268-331 UniProt: 7-70 -------------- PROSITE (2) Transcript -------------------------------------------------------------------------------------------- Transcript 1xb0 A 254 TNLPRNPSMTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLT 345 263 273 283 293 303 313 323 333 343 Chain B from PDB Type:PROTEIN Length:101 aligned with BIRC8_HUMAN | Q96P09 from UniProtKB/Swiss-Prot Length:236 Alignment length:101 1 | 4 14 24 34 44 54 64 74 84 94 BIRC8_HUMAN - ------MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTT 95 SCOP domains d1xb0b_ B: BIR-containing protein 8 SCOP domains CATH domains 1xb0B00 B:256-356 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---------BIR_REPEAT_1 PDB: B:265-330 UniProt: 4-69 -------------------------- PROSITE (1) PROSITE (2) ------------BIR_REPEAT_2 PDB: B:268-331 UniProt: 7-70 ------------------------- PROSITE (2) Transcript ----------------------------------------------------------------------------------------------------- Transcript 1xb0 B 256 LPRNPSMTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTT 356 265 275 285 295 305 315 325 335 345 355 Chain C from PDB Type:PROTEIN Length:91 aligned with BIRC8_HUMAN | Q96P09 from UniProtKB/Swiss-Prot Length:236 Alignment length:91 1 | 3 13 23 33 43 53 63 73 83 BIRC8_HUMAN - -------MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLT 84 SCOP domains d1xb0c_ C: BIR-containing protein 8 SCOP domains CATH domains 1xb0C00 C:255-345 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains ------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ----------BIR_REPEAT_1 PDB: C:265-330 UniProt: 4-69 --------------- PROSITE (1) PROSITE (2) -------------BIR_REPEAT_2 PDB: C:268-331 UniProt: 7-70 -------------- PROSITE (2) Transcript ------------------------------------------------------------------------------------------- Transcript 1xb0 C 255 NLPRNPSMTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLT 345 264 274 284 294 304 314 324 334 344 Chain D from PDB Type:PROTEIN Length:91 aligned with BIRC8_HUMAN | Q96P09 from UniProtKB/Swiss-Prot Length:236 Alignment length:91 1 | 3 13 23 33 43 53 63 73 83 BIRC8_HUMAN - -------MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLT 84 SCOP domains d1xb0d_ D: BIR-containing protein 8 SCOP domains CATH domains 1xb0D00 D:255-345 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains ------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ----------BIR_REPEAT_1 PDB: D:265-330 UniProt: 4-69 --------------- PROSITE (1) PROSITE (2) -------------BIR_REPEAT_2 PDB: D:268-331 UniProt: 7-70 -------------- PROSITE (2) Transcript ------------------------------------------------------------------------------------------- Transcript 1xb0 D 255 NLPRNPSMTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLT 345 264 274 284 294 304 314 324 334 344 Chain E from PDB Type:PROTEIN Length:93 aligned with BIRC8_HUMAN | Q96P09 from UniProtKB/Swiss-Prot Length:236 Alignment length:93 1 | 3 13 23 33 43 53 63 73 83 BIRC8_HUMAN - -------MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLTRS 86 SCOP domains d1xb0e_ E: BIR-containing protein 8 SCOP domains CATH domains 1xb0E00 E:255-347 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains --------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ----------BIR_REPEAT_1 PDB: E:265-330 UniProt: 4-69 ----------------- PROSITE (1) PROSITE (2) -------------BIR_REPEAT_2 PDB: E:268-331 UniProt: 7-70 ---------------- PROSITE (2) Transcript --------------------------------------------------------------------------------------------- Transcript 1xb0 E 255 NLPRNPSMTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLTRS 347 264 274 284 294 304 314 324 334 344 Chain F from PDB Type:PROTEIN Length:103 aligned with BIRC8_HUMAN | Q96P09 from UniProtKB/Swiss-Prot Length:236 Alignment length:103 1 |2 12 22 32 42 52 62 72 82 92 BIRC8_HUMAN - --------MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTT 95 SCOP domains d1xb0f_ F: BIR-containing protein 8 SCOP domains CATH domains 1xb0F00 F:254-356 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains (1) --------------BIR-1xb0F01 F:268-331 ------------------------- Pfam domains (1) Pfam domains (2) --------------BIR-1xb0F02 F:268-331 ------------------------- Pfam domains (2) Pfam domains (3) --------------BIR-1xb0F03 F:268-331 ------------------------- Pfam domains (3) Pfam domains (4) --------------BIR-1xb0F04 F:268-331 ------------------------- Pfam domains (4) Pfam domains (5) --------------BIR-1xb0F05 F:268-331 ------------------------- Pfam domains (5) Pfam domains (6) --------------BIR-1xb0F06 F:268-331 ------------------------- Pfam domains (6) SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------BIR_REPEAT_1 PDB: F:265-330 UniProt: 4-69 -------------------------- PROSITE (1) PROSITE (2) --------------BIR_REPEAT_2 PDB: F:268-331 UniProt: 7-70 ------------------------- PROSITE (2) Transcript ------------------------------------------------------------------------------------------------------- Transcript 1xb0 F 254 TNLPRNPSMTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTT 356 263 273 283 293 303 313 323 333 343 353 Chain G from PDB Type:PROTEIN Length:4 aligned with DBLOH_HUMAN | Q9NR28 from UniProtKB/Swiss-Prot Length:239 Alignment length:4 DBLOH_HUMAN 56 AVPI 59 SCOP domains ---- SCOP domains CATH domains ---- CATH domains Pfam domains ---- Pfam domains SAPs(SNPs) ---- SAPs(SNPs) PROSITE ---- PROSITE Transcript ---- Transcript 1xb0 G 901 AVPI 904 Chain H from PDB Type:PROTEIN Length:4 aligned with DBLOH_HUMAN | Q9NR28 from UniProtKB/Swiss-Prot Length:239 Alignment length:4 DBLOH_HUMAN 56 AVPI 59 SCOP domains ---- SCOP domains CATH domains ---- CATH domains Pfam domains ---- Pfam domains SAPs(SNPs) ---- SAPs(SNPs) PROSITE ---- PROSITE Transcript ---- Transcript 1xb0 H 901 AVPI 904 Chain I from PDB Type:PROTEIN Length:4 aligned with DBLOH_HUMAN | Q9NR28 from UniProtKB/Swiss-Prot Length:239 Alignment length:4 DBLOH_HUMAN 56 AVPI 59 SCOP domains ---- SCOP domains CATH domains ---- CATH domains Pfam domains ---- Pfam domains SAPs(SNPs) ---- SAPs(SNPs) PROSITE ---- PROSITE Transcript ---- Transcript 1xb0 I 901 AVPI 904 Chain J from PDB Type:PROTEIN Length:5 aligned with DBLOH_HUMAN | Q9NR28 from UniProtKB/Swiss-Prot Length:239 Alignment length:5 DBLOH_HUMAN 56 AVPIA 60 SCOP domains ----- SCOP domains CATH domains ----- CATH domains Pfam domains ----- Pfam domains SAPs(SNPs) ----- SAPs(SNPs) PROSITE ----- PROSITE Transcript ----- Transcript 1xb0 J 901 AVPIA 905 Chain K from PDB Type:PROTEIN Length:4 aligned with DBLOH_HUMAN | Q9NR28 from UniProtKB/Swiss-Prot Length:239 Alignment length:4 DBLOH_HUMAN 56 AVPI 59 SCOP domains ---- SCOP domains CATH domains ---- CATH domains Pfam domains ---- Pfam domains SAPs(SNPs) ---- SAPs(SNPs) PROSITE ---- PROSITE Transcript ---- Transcript 1xb0 K 901 AVPI 904 Chain L from PDB Type:PROTEIN Length:4 aligned with DBLOH_HUMAN | Q9NR28 from UniProtKB/Swiss-Prot Length:239 Alignment length:4 DBLOH_HUMAN 56 AVPI 59 SCOP domains ---- SCOP domains CATH domains ---- CATH domains Pfam domains (1) Smac Pfam domains (1) Pfam domains (2) Smac Pfam domains (2) Pfam domains (3) Smac Pfam domains (3) Pfam domains (4) Smac Pfam domains (4) Pfam domains (5) Smac Pfam domains (5) Pfam domains (6) Smac Pfam domains (6) SAPs(SNPs) ---- SAPs(SNPs) PROSITE ---- PROSITE Transcript ---- Transcript 1xb0 L 901 AVPI 904
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B,C,D,E,F (BIRC8_HUMAN | Q96P09)
Chain G,H,I,J,K,L (DBLOH_HUMAN | Q9NR28)
|
|
|
|
|
|
|