Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  THE PROSTAPHOPAIN B STRUCTURE
 
Authors :  R. Filipek, R. Szczepanowski, A. Sabat, J. Potempa, M. Bochtler
Date :  24 Aug 04  (Deposition) - 23 Nov 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Half-Barrel, Barrel-Sandwich-Hybrid, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Filipek, R. Szczepanowski, A. Sabat, J. Potempa, M. Bochtler
Prostaphopain B Structure: A Comparison Of Proregion-Mediated And Staphostatin-Mediated Protease Inhibition.
Biochemistry V. 43 14306 2004
PubMed-ID: 15518582  |  Reference-DOI: 10.1021/BI048661M
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYSTEINE PROTEINASE
    Chains: A, B, C, D
    EC Number: 3.4.22.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PGEX-5T
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: PROENZYME (RESIDUES 37-393)
    Gene: SSPB
    Organism Scientific: STAPHYLOCOCCUS AUREUS
    Organism Taxid: 1280

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A   
Biological Unit 2 (1x):  B  
Biological Unit 3 (1x):   C 
Biological Unit 4 (1x):    D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1X9Y)

(-) Sites  (0, 0)

(no "Site" information available for 1X9Y)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1X9Y)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1X9Y)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1X9Y)

(-) PROSITE Motifs  (1, 4)

Asymmetric Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1THIOL_PROTEASE_HISPS00639 Eukaryotic thiol (cysteine) proteases histidine active site.SSPB_STAA8338-348
 
 
 		  4A:338-348
B:338-348
C:338-348
D:338-348
SSPB_STAAU338-348
 
 
 		  4A:338-348
B:338-348
C:338-348
D:338-348
Biological Unit 1 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1THIOL_PROTEASE_HISPS00639 Eukaryotic thiol (cysteine) proteases histidine active site.SSPB_STAA8338-348
 
 
 		  1A:338-348
-
-
-
SSPB_STAAU338-348
 
 
 		  1A:338-348
-
-
-
Biological Unit 2 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1THIOL_PROTEASE_HISPS00639 Eukaryotic thiol (cysteine) proteases histidine active site.SSPB_STAA8338-348
 
 
 		  1-
B:338-348
-
-
SSPB_STAAU338-348
 
 
 		  1-
B:338-348
-
-
Biological Unit 3 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1THIOL_PROTEASE_HISPS00639 Eukaryotic thiol (cysteine) proteases histidine active site.SSPB_STAA8338-348
 
 
 		  1-
-
C:338-348
-
SSPB_STAAU338-348
 
 
 		  1-
-
C:338-348
-
Biological Unit 4 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1THIOL_PROTEASE_HISPS00639 Eukaryotic thiol (cysteine) proteases histidine active site.SSPB_STAA8338-348
 
 
 		  1-
-
-
D:338-348
SSPB_STAAU338-348
 
 
 		  1-
-
-
D:338-348

(-) Exons   (0, 0)

(no "Exon" information available for 1X9Y)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:346
 aligned with SSPB_STAA8 | Q2FZL3 from UniProtKB/Swiss-Prot  Length:393

    Alignment length:357
                                                                                                                                                                                                                                                                                                                                                                                          393    
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390  |    
           SSPB_STAA8    41 KQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLPGNVKEKESAKTVSAKLKQELKNTVTPTKVEENEAIQEDQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY----   -
               SCOP domains d1x9ya2 A:41-211 Staphopain B, prodomain                                                                                                                                   -----------d1x9ya1 A:223-393 Staphopain SspB                                                                                                                                          ---- SCOP domains
               CATH domains 1x9yA01 A:41-210 prostaphopain b, domain 1                                                                                                                                1           x9yA02 A:211-397 Cysteine proteinases                                                                                                                                           CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.....hhhhhhhhhhhhhhhhhhhhhhh......eee......ee........eeeeeee..eeeeeeeeee.hhhhhhh......eeeeee..hhhhhhhh.....eeeeeee..eeeeee..eeeeeee................hhhhhhhh.eee.....-----------.eeee..............hhhhhhhhhhhhhhh.....hhhhhhhhhh......hhhhh..hhhhhhhhhhhh.eeeeeee...hhhhhhhhhhh...eeeeeee...........eeeeeeeeeee..eeeeeee.......eeee....eee.....eeeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------THIOL_PROTE------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1x9y A  41 KQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLANNIKEKESAKTVSPQLKQELKTTVTPTKV-----------QYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGYLEVP 397
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210|        -  |    230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       
                                                                                                                                                                                                    211         223                                                                                                                                                                              


Chain A from PDB  Type:PROTEIN  Length:346
 aligned with SSPB_STAAU | P0C1S6 from UniProtKB/Swiss-Prot  Length:393

    Alignment length:357
                                                                                                                                                                                                                                                                                                                                                                                          393    
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390  |    
           SSPB_STAAU    41 KQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLANNIKEKESAKTVSPQLKQELKTTVTPTKVEENEAIQEDQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY----   -
               SCOP domains d1x9ya2 A:41-211 Staphopain B, prodomain                                                                                                                                   -----------d1x9ya1 A:223-393 Staphopain SspB                                                                                                                                          ---- SCOP domains
               CATH domains 1x9yA01 A:41-210 prostaphopain b, domain 1                                                                                                                                1           x9yA02 A:211-397 Cysteine proteinases                                                                                                                                           CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.....hhhhhhhhhhhhhhhhhhhhhhh......eee......ee........eeeeeee..eeeeeeeeee.hhhhhhh......eeeeee..hhhhhhhh.....eeeeeee..eeeeee..eeeeeee................hhhhhhhh.eee.....-----------.eeee..............hhhhhhhhhhhhhhh.....hhhhhhhhhh......hhhhh..hhhhhhhhhhhh.eeeeeee...hhhhhhhhhhh...eeeeeee...........eeeeeeeeeee..eeeeeee.......eeee....eee.....eeeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------THIOL_PROTE------------------------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1x9y A  41 KQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLANNIKEKESAKTVSPQLKQELKTTVTPTKV-----------QYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGYLEVP 397
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210|        -  |    230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       
                                                                                                                                                                                                    211         223                                                                                                                                                                              


Chain B from PDB  Type:PROTEIN  Length:346
 aligned with SSPB_STAA8 | Q2FZL3 from UniProtKB/Swiss-Prot  Length:393

    Alignment length:357
                                                                                                                                                                                                                                                                                                                                                                                          393    
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390  |    
           SSPB_STAA8    41 KQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLPGNVKEKESAKTVSAKLKQELKNTVTPTKVEENEAIQEDQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY----   -
               SCOP domains d1x9yb2 B:41-211 Staphopain B, prodomain                                                                                                                                   -----------d1x9yb1 B:223-393 Staphopain SspB                                                                                                                                          ---- SCOP domains
               CATH domains 1x9yB01 B:41-210 prostaphopain b, domain 1                                                                                                                                1           x9yB02 B:211-397 Cysteine proteinases                                                                                                                                           CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.....hhhhhhhhhhhhhhhhhhhhhhhh.....eee......ee........eeeeeee..eeeeeeeeee.hhhhhhh......eeeeee..hhhhhhhh.....eeeeeee..eeeeee..eeeeeee................hhhhhh...eee.....-----------.eeee..............hhhhhhhhhhhhhhh.....hhhhhhhhhh......hhhhh..hhhhhhhhhhhh.eeeeeee...hhhhhhhhhhh..eeeeeeee...........eeeeeeeeeee..eeeeeee.......eeee....eee.....eeeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------THIOL_PROTE------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1x9y B  41 KQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLANNIKEKESAKTVSPQLKQELKTTVTPTKV-----------QYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGYLEVP 397
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210|        -  |    230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       
                                                                                                                                                                                                    211         223                                                                                                                                                                              


Chain B from PDB  Type:PROTEIN  Length:346
 aligned with SSPB_STAAU | P0C1S6 from UniProtKB/Swiss-Prot  Length:393

    Alignment length:357
                                                                                                                                                                                                                                                                                                                                                                                          393    
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390  |    
           SSPB_STAAU    41 KQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLANNIKEKESAKTVSPQLKQELKTTVTPTKVEENEAIQEDQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY----   -
               SCOP domains d1x9yb2 B:41-211 Staphopain B, prodomain                                                                                                                                   -----------d1x9yb1 B:223-393 Staphopain SspB                                                                                                                                          ---- SCOP domains
               CATH domains 1x9yB01 B:41-210 prostaphopain b, domain 1                                                                                                                                1           x9yB02 B:211-397 Cysteine proteinases                                                                                                                                           CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.....hhhhhhhhhhhhhhhhhhhhhhhh.....eee......ee........eeeeeee..eeeeeeeeee.hhhhhhh......eeeeee..hhhhhhhh.....eeeeeee..eeeeee..eeeeeee................hhhhhh...eee.....-----------.eeee..............hhhhhhhhhhhhhhh.....hhhhhhhhhh......hhhhh..hhhhhhhhhhhh.eeeeeee...hhhhhhhhhhh..eeeeeeee...........eeeeeeeeeee..eeeeeee.......eeee....eee.....eeeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------THIOL_PROTE------------------------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1x9y B  41 KQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLANNIKEKESAKTVSPQLKQELKTTVTPTKV-----------QYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGYLEVP 397
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210|        -  |    230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       
                                                                                                                                                                                                    211         223                                                                                                                                                                              


Chain C from PDB  Type:PROTEIN  Length:346
 aligned with SSPB_STAA8 | Q2FZL3 from UniProtKB/Swiss-Prot  Length:393

    Alignment length:357
                                                                                                                                                                                                                                                                                                                                                                                          393    
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390  |    
           SSPB_STAA8    41 KQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLPGNVKEKESAKTVSAKLKQELKNTVTPTKVEENEAIQEDQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY----   -
               SCOP domains d1x9yc2 C:41-211 Staphopain B, prodomain                                                                                                                                   -----------d1x9yc1 C:223-393 Staphopain SspB                                                                                                                                          ---- SCOP domains
               CATH domains 1x9yC01 C:41-210 prostaphopain b, domain 1                                                                                                                                1           x9yC02 C:211-397 Cysteine proteinases                                                                                                                                           CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.....hhhhhhhhhhhhhhhhhhhhhh.......eee......ee........eeeeeee..eeeeeeeeee.hhhhhhh......eeeeee..hhhhhhh......eeeeeee..eeeeee..eeeeeee................hhhhhhhh.eee.....-----------.eeee..............hhhhhhhhhhhhhhh.....hhhhhhhhhh......hhhhh..hhhhhhhhhhhh.eeeeeee...hhhhhhhhhhh..eeeeeeee...........eeeeeeeeeee..eeeeeee.......eeee....eee.hhh.eeeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------THIOL_PROTE------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1x9y C  41 KQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLANNIKEKESAKTVSPQLKQELKTTVTPTKV-----------QYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGYLEVP 397
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210|        -  |    230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       
                                                                                                                                                                                                    211         223                                                                                                                                                                              


Chain C from PDB  Type:PROTEIN  Length:346
 aligned with SSPB_STAAU | P0C1S6 from UniProtKB/Swiss-Prot  Length:393

    Alignment length:357
                                                                                                                                                                                                                                                                                                                                                                                          393    
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390  |    
           SSPB_STAAU    41 KQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLANNIKEKESAKTVSPQLKQELKTTVTPTKVEENEAIQEDQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY----   -
               SCOP domains d1x9yc2 C:41-211 Staphopain B, prodomain                                                                                                                                   -----------d1x9yc1 C:223-393 Staphopain SspB                                                                                                                                          ---- SCOP domains
               CATH domains 1x9yC01 C:41-210 prostaphopain b, domain 1                                                                                                                                1           x9yC02 C:211-397 Cysteine proteinases                                                                                                                                           CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.....hhhhhhhhhhhhhhhhhhhhhh.......eee......ee........eeeeeee..eeeeeeeeee.hhhhhhh......eeeeee..hhhhhhh......eeeeeee..eeeeee..eeeeeee................hhhhhhhh.eee.....-----------.eeee..............hhhhhhhhhhhhhhh.....hhhhhhhhhh......hhhhh..hhhhhhhhhhhh.eeeeeee...hhhhhhhhhhh..eeeeeeee...........eeeeeeeeeee..eeeeeee.......eeee....eee.hhh.eeeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------THIOL_PROTE------------------------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1x9y C  41 KQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLANNIKEKESAKTVSPQLKQELKTTVTPTKV-----------QYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGYLEVP 397
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210|        -  |    230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       
                                                                                                                                                                                                    211         223                                                                                                                                                                              


Chain D from PDB  Type:PROTEIN  Length:346
 aligned with SSPB_STAA8 | Q2FZL3 from UniProtKB/Swiss-Prot  Length:393

    Alignment length:357
                                                                                                                                                                                                                                                                                                                                                                                          393    
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390  |    
           SSPB_STAA8    41 KQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLPGNVKEKESAKTVSAKLKQELKNTVTPTKVEENEAIQEDQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY----   -
               SCOP domains d1x9yd2 D:41-211 Staphopain B, prodomain                                                                                                                                   -----------d1x9yd1 D:223-393 Staphopain SspB                                                                                                                                          ---- SCOP domains
               CATH domains 1x9yD01 D:41-210 prostaphopain b, domain 1                                                                                                                                1           x9yD02 D:211-397 Cysteine proteinases                                                                                                                                           CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Peptidase_C47-1x9yD01 D:223-393                                                                                                                                            ---- Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Peptidase_C47-1x9yD02 D:223-393                                                                                                                                            ---- Pfam domains (2)
           Pfam domains (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Peptidase_C47-1x9yD03 D:223-393                                                                                                                                            ---- Pfam domains (3)
           Pfam domains (4) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Peptidase_C47-1x9yD04 D:223-393                                                                                                                                            ---- Pfam domains (4)
         Sec.struct. author ...eeee.....hhhhhhhhhhhhhhhhhhhhhhh......eee......ee........eeeeeee..eeeeeeeeee.hhhhhhh......eeeeee..hhhhhhh......eeeeeee..eeeeee..eeeeeee................hhhhhhhh.eee.....-----------.eeee..............hhhhhhhhhhhhhhh.....hhhhhhhhhh......hhhhh..hhhhhhhhhhhh.eeeeeee...hhhhhhhhhhh..eeeeeeee...........eeeeeeeeeee..eeeeeee.......eeee....eee.....eeeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------THIOL_PROTE------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1x9y D  41 KQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLANNIKEKESAKTVSPQLKQELKTTVTPTKV-----------QYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGYLEVP 397
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210|        -  |    230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       
                                                                                                                                                                                                    211         223                                                                                                                                                                              


Chain D from PDB  Type:PROTEIN  Length:346
 aligned with SSPB_STAAU | P0C1S6 from UniProtKB/Swiss-Prot  Length:393

    Alignment length:357
                                                                                                                                                                                                                                                                                                                                                                                          393    
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390  |    
           SSPB_STAAU    41 KQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLANNIKEKESAKTVSPQLKQELKTTVTPTKVEENEAIQEDQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY----   -
               SCOP domains d1x9yd2 D:41-211 Staphopain B, prodomain                                                                                                                                   -----------d1x9yd1 D:223-393 Staphopain SspB                                                                                                                                          ---- SCOP domains
               CATH domains 1x9yD01 D:41-210 prostaphopain b, domain 1                                                                                                                                1           x9yD02 D:211-397 Cysteine proteinases                                                                                                                                           CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Peptidase_C47-1x9yD01 D:223-393                                                                                                                                            ---- Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Peptidase_C47-1x9yD02 D:223-393                                                                                                                                            ---- Pfam domains (2)
           Pfam domains (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Peptidase_C47-1x9yD03 D:223-393                                                                                                                                            ---- Pfam domains (3)
           Pfam domains (4) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Peptidase_C47-1x9yD04 D:223-393                                                                                                                                            ---- Pfam domains (4)
         Sec.struct. author ...eeee.....hhhhhhhhhhhhhhhhhhhhhhh......eee......ee........eeeeeee..eeeeeeeeee.hhhhhhh......eeeeee..hhhhhhh......eeeeeee..eeeeee..eeeeeee................hhhhhhhh.eee.....-----------.eeee..............hhhhhhhhhhhhhhh.....hhhhhhhhhh......hhhhh..hhhhhhhhhhhh.eeeeeee...hhhhhhhhhhh..eeeeeeee...........eeeeeeeeeee..eeeeeee.......eeee....eee.....eeeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------THIOL_PROTE------------------------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1x9y D  41 KQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLANNIKEKESAKTVSPQLKQELKTTVTPTKV-----------QYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGYLEVP 397
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210|        -  |    230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       
                                                                                                                                                                                                    211         223
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 8)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (2, 8)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 4)

Asymmetric Unit
(-)
Clan: Peptidase_CA (169)

(-) Gene Ontology  (6, 12)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (SSPB_STAA8 | Q2FZL3)
molecular function
    GO:0008234    cysteine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain A,B,C,D   (SSPB_STAAU | P0C1S6)
molecular function
    GO:0008234    cysteine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1x9y)
 
  Sites
(no "Sites" information available for 1x9y)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1x9y)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1x9y
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SSPB_STAA8 | Q2FZL3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  SSPB_STAAU | P0C1S6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.22.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  SSPB_STAA8 | Q2FZL3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SSPB_STAAU | P0C1S6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SSPB_STAA8 | Q2FZL3: 1pxv 1y4h
        SSPB_STAAU | P0C1S6: 1pxv 1y4h

(-) Related Entries Specified in the PDB File

1cv8 1pxv