|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1WWQ) |
(no "Site" information available for 1WWQ) |
(no "SS Bond" information available for 1WWQ) |
(no "Cis Peptide Bond" information available for 1WWQ) |
(no "SAP(SNP)/Variant" information available for 1WWQ) |
NMR Structure (1, 1) |
(no "Exon" information available for 1WWQ) |
NMR StructureChain A from PDB Type:PROTEIN Length:111 aligned with ERH_MOUSE | P84089 from UniProtKB/Swiss-Prot Length:104 Alignment length:111 1 | 3 13 23 33 43 53 63 73 83 93 103 ERH_MOUSE - -------MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK 104 SCOP domains -------d1wwqa1 A:8-111 Enhancer of rudimentary homolog, ERH SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------ER-1wwqA01 A:8-110 - Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------ER PDB: A:59-75 ------------------------------------ PROSITE Transcript --------------------------------------------------------------------------------------------------------------- Transcript 1wwq A 1 GSEGAATMSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK 111 10 20 30 40 50 60 70 80 90 100 110
|
NMR Structure |
(no "CATH Domain" information available for 1WWQ) |
NMR Structure |
NMR Structure(hide GO term definitions) Chain A (ERH_MOUSE | P84089)
|
|
|
|
|
|
|